1T01: Vinculin

Vinculin complexed with the VBS1 helix from talin. Determined by X-ray diffraction at 2.06 Å resolution. Released 24 Aug 2004.

Method: X-ray diffraction
Resolution: 2.06 Å
Organisms: Gallus gallus, Mus musculus
Chains: 2
Atoms: 2,471
Mol. weight: 30.93 kDa
Released: 24 Aug 2004

Explore 1T01 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T01 contains 10 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-4	2
β-strand	6	1	1
α-helix	7-26	20
α-helix	36-39	4
α-helix	41-62	22
α-helix	68-97	30
α-helix	102-145	44
α-helix	154-181	28
β-strand	182	1	1
α-helix	185-215	31
α-helix	223-248	26

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	606-626	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
unnamed protein product	A	protein	255	Gallus gallus	P12003 (AlphaFold model)
Talin 1	B	protein	24	Mus musculus	P26039 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1T01_1 unnamed protein product (chains A)
AMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGK
ETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGT
SDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQ
QELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSA
EINEIIRVLQLTSWD

Sequence of entity 2 (B), FASTA

>1T01_2 Talin 1 (chains B)
GRPLLQAAKGLAGAVSELLRSAQP

Primary citation

Activation of a vinculin-binding site in the talin rod involves rearrangement of a five-helix bundle. PAPAGRIGORIOU, E., GINGRAS, A.R., BARSUKOV, I.L. et al. EMBO J (2004) 23:2942-2951. DOI 10.1038/sj.emboj.7600285 · PubMed

Other PDB entries of the same protein (UniProt P12003 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QKR 1.8 Å, Crystal structure of the vinculin tail and a pathway for activation
1ZVZ 1.8 Å, Vinculin Head (0-258) in Complex with the Talin Rod Residue 820-844
1ZW2 2.1 Å, Vinculin Head (0-258) in Complex with the Talin Rod residues 2345-2369
3ZDL 2.3 Å, Vinculin head (1-258) in complex with a RIAM fragment
4E17 2.3 Å, Alpha-E-catenin is an autoinhibited molecule that co-activates vinculin
1U6H 2.38 Å, Vinculin head (0-258) in complex with the talin vinculin binding site 2 (849-879)
4E18 2.4 Å, Alpha-E-catenin is an autoinhibited molecule that co-activates vinculin
1XWJ 2.6 Å, Vinculin head (1-258) in complex with the talin vinculin binding site 3 (1945-1969)
2GDC 2.74 Å, Structure of Vinculin VD1 / IpaA560-633 complex
6FQ4 2.89 Å, Structure of Chlamydial virulence factor TarP and vinculin head domain
6NR7 3.0 Å, Rerefinement of chicken vinculin
1ST6 3.1 Å, Crystal structure of a cytoskeletal protein

Browse structure collections

About this viewer

MolViewer shows 1T01 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.