6FQ4: Vinculin

Structure of Chlamydial virulence factor TarP and vinculin head domain. Determined by X-ray diffraction at 2.89 Å resolution. Released 9 May 2018.

Method: X-ray diffraction
Resolution: 2.89 Å
Organisms: Gallus gallus, Chlamydia caviae
Chains: 2
Atoms: 2,085
Mol. weight: 33.51 kDa
Released: 9 May 2018

Explore 6FQ4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FQ4 contains 9 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	6	1	1
α-helix	7-28	22
α-helix	41-63	23
α-helix	69-97	29
α-helix	102-146	45
α-helix	154-181	28
β-strand	182	1	1
α-helix	185-216	32
α-helix	223-247	25

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	853-864	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vinculin	A	protein	280	Gallus gallus	P12003 (AlphaFold model)
TarP-VBS1	B	protein	20	Chlamydia caviae	Q824H6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6FQ4_1 Vinculin (chains A)
MGSSHHHHHHSSGLVPRGSHMMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPD
LTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADP
YSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVT
YTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTK
SQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWA

Sequence of entity 2 (B), FASTA

>6FQ4_2 TarP-VBS1 (chains B)
LLEAARNTTTMLSKTLSKVC

Primary citation

Chlamydial virulence factor TarP mimics talin to disrupt the talin-vinculin complex. Whitewood, A.J., Singh, A.K., Brown, D.G. et al. FEBS Lett (2018) 592:1751-1760. DOI 10.1002/1873-3468.13074 · PubMed

Other PDB entries of the same protein (UniProt P12003 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QKR 1.8 Å, Crystal structure of the vinculin tail and a pathway for activation
1ZVZ 1.8 Å, Vinculin Head (0-258) in Complex with the Talin Rod Residue 820-844
1T01 2.06 Å, Vinculin complexed with the VBS1 helix from talin
1ZW2 2.1 Å, Vinculin Head (0-258) in Complex with the Talin Rod residues 2345-2369
3ZDL 2.3 Å, Vinculin head (1-258) in complex with a RIAM fragment
4E17 2.3 Å, Alpha-E-catenin is an autoinhibited molecule that co-activates vinculin
1U6H 2.38 Å, Vinculin head (0-258) in complex with the talin vinculin binding site 2 (849-879)
4E18 2.4 Å, Alpha-E-catenin is an autoinhibited molecule that co-activates vinculin
1XWJ 2.6 Å, Vinculin head (1-258) in complex with the talin vinculin binding site 3 (1945-1969)
2GDC 2.74 Å, Structure of Vinculin VD1 / IpaA560-633 complex
6NR7 3.0 Å, Rerefinement of chicken vinculin
1ST6 3.1 Å, Crystal structure of a cytoskeletal protein

Browse structure collections

About this viewer

MolViewer shows 6FQ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.