1QLK: S-100 protein

Solution structure of CA(2+)-loaded rat S100B (betabeta) NMR, 20 structures. Determined by solution NMR. Released 11 Nov 1998.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,506
Mol. weight: 21.68 kDa
Ligands: CA
Released: 11 Nov 1998

Explore 1QLK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QLK contains 10 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-18	17
β-strand	27	1	1
α-helix	29-39	11
α-helix	40-42	3
α-helix	50-60	11
β-strand	68	1	1
α-helix	70-83	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-100 protein	A, B	protein	92	Rattus norvegicus	P04631 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1QLK_1 S-100 PROTEIN (chains A, B)
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDEDGDGECDFQEFMAFVSMVTTACHEFFEHE

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Solution structure of calcium-bound rat S100B(betabeta) as determined by nuclear magnetic resonance spectroscopy,. Drohat, A.C., Baldisseri, D.M., Rustandi, R.R. et al. Biochemistry (1998) 37:2729-2740. DOI 10.1021/bi972635p · PubMed

Other PDB entries of the same protein (UniProt P04631 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1B4C Solution structure of rat apo-S100B using dipolar couplings
1DT7 Solution structure of the C-terminal negative regulatory domain of P53 in a complex with…
1MWN Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12
1SYM 3-D solution structure of reduced apo-S100B from rat, NMR, 20 structures
1XYD NMR Solution Structure of Rat Zinc-Calcium-S100B, 20 Structures
2K7O Ca2+-S100B, refined with RDCs

Browse structure collections

About this viewer

MolViewer shows 1QLK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.