Crystal Structure of N-Terminal Domain of Human Platelet Receptor Glycoprotein Ib-alpha at 2.8 Angstrom Resolution. Determined by X-ray diffraction at 2.8 Å resolution. Released 2 Mar 2004.
Explore 1QYY in 3D Show helices and sheets RCSB PDB PDBe
1QYY contains 14 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-6 | 2 | 1 |
| β-strand | 13-16 | 4 | 1 |
| β-strand | 33-37 | 5 | 1 |
| β-strand | 45-47 | 3 | 2 |
| α-helix | 48-51 | 4 | |
| β-strand | 59-61 | 3 | 1 |
| β-strand | 69-71 | 3 | 2 |
| β-strand | 81-83 | 3 | 1 |
| β-strand | 104-106 | 3 | 1 |
| β-strand | 128-130 | 3 | 1 |
| β-strand | 152-154 | 3 | 1 |
| β-strand | 176-178 | 3 | 1 |
| β-strand | 199-201 | 3 | 1 |
| α-helix | 211-213 | 3 | |
| α-helix | 214-222 | 9 | |
| α-helix | 224-226 | 3 | |
| β-strand | 227 | 1 | 1 |
| α-helix | 243-245 | 3 | |
| β-strand | 247 | 1 | 3 |
| α-helix | 248-250 | 3 | |
| β-strand | 255 | 1 | 3 |
| α-helix | 256-258 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 4 |
| β-strand | 4 | 1 | 4 |
| β-strand | 5 | 1 | 5 |
| β-strand | 14-16 | 3 | 5 |
| α-helix | 25-26 | 2 | |
| β-strand | 35-37 | 3 | 5 |
| β-strand | 45-47 | 3 | 6 |
| α-helix | 48-51 | 4 | |
| β-strand | 59-61 | 3 | 5 |
| β-strand | 69-71 | 3 | 6 |
| β-strand | 81-83 | 3 | 5 |
| β-strand | 104-106 | 3 | 5 |
| β-strand | 128-130 | 3 | 5 |
| β-strand | 152-154 | 3 | 5 |
| β-strand | 176-178 | 3 | 5 |
| β-strand | 199-201 | 3 | 5 |
| β-strand | 207 | 1 | 7 |
| α-helix | 211-213 | 3 | |
| α-helix | 214-222 | 9 | |
| α-helix | 224-226 | 3 | |
| β-strand | 227 | 1 | 5 |
| α-helix | 243-245 | 3 | |
| β-strand | 247 | 1 | 8 |
| β-strand | 248 | 1 | 7 |
| β-strand | 255 | 1 | 8 |
| α-helix | 256-258 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Platelet glycoprotein Ib alpha chain | A, G | protein | 290 | Homo sapiens | P07359 (AlphaFold model) |
>1QYY_1 Platelet glycoprotein Ib alpha chain (chains A, G) HPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQL NLDRAELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGAL RGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQ ENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMT SNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDTEGDKVR
Platinum-induced space-group transformation in crystals of the platelet glycoprotein Ib alpha N-terminal domain. Varughese, K.I., Ruggeri, Z.M., Celikel, R. Acta Crystallogr D Biol Crystallogr (2004) 60:405-411. DOI 10.1107/S0907444903026805 · PubMed
Other PDB entries of the same protein (UniProt P07359 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1QYY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.