1QZ2: FK506-binding protein 4

Crystal Structure of FKBP52 C-terminal Domain complex with the C-terminal peptide MEEVD of Hsp90. Determined by X-ray diffraction at 3.0 Å resolution. Released 22 Jun 2004.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 5
Atoms: 7,225
Mol. weight: 116.45 kDa
Released: 22 Jun 2004

Explore 1QZ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QZ2 contains 35 α-helices and 25 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	150-156	7	1
β-strand	169-178	10	1
β-strand	181-186	6	1
β-strand	189-191	3	1
α-helix	195-198	4
α-helix	202-208	7
β-strand	216-221	6	1
α-helix	223-225	3
β-strand	232	1	2
β-strand	237	1	2
β-strand	243-253	11	1
α-helix	254-257	4
α-helix	258-260	3
α-helix	263-282	20
α-helix	286-300	15
α-helix	308-331	24
α-helix	335-349	15
α-helix	353-365	13
α-helix	369-382	14
α-helix	387-423	37

Chain B: 13 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	150-153	4	3
β-strand	169-171	3	4
β-strand	173	1	3
β-strand	176-177	2	3
β-strand	182-184	3	3
β-strand	189-191	3	4
α-helix	195-198	4
α-helix	202-208	7
β-strand	216-221	6	3
α-helix	223-225	3
α-helix	228-230	3
α-helix	233-235	3
β-strand	243-248	6	3
β-strand	252-253	2	4
α-helix	258-260	3
α-helix	263-282	20
α-helix	286-299	14
α-helix	309-332	24
α-helix	335-348	14
α-helix	353-365	13
α-helix	369-382	14
α-helix	387-423	37

Chain C: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	150-152	3	5
β-strand	156	1	5
β-strand	169-177	9	5
β-strand	182-191	10	5
α-helix	195-198	4
α-helix	202-209	8
β-strand	216	1	5
β-strand	219-221	3	5
β-strand	243-245	3	5
β-strand	248-253	6	5
α-helix	258-260	3
α-helix	263-282	20
α-helix	286-299	14
α-helix	309-331	23
α-helix	335-346	12
α-helix	353-365	13
α-helix	369-382	14
α-helix	387-422	36

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FK506-binding protein 4	A, B, C	protein	336	Homo sapiens	Q02790 (AlphaFold model)
5-mer peptide from Heat shock protein HSP 90	G, H	protein	5		P08238 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1QZ2_1 FK506-binding protein 4 (chains A, B, C)
MGSSHHHHHHSSGLVPRGSHMEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLF
DQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAEL
KYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYE
SSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAH
LAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEEN
KAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA

Sequence of entity 2 (G, H), FASTA

>1QZ2_2 5-mer peptide from Heat shock protein HSP 90 (chains G, H)
MEEVD

Primary citation

3D structure of human FK506-binding protein 52: Implications for the assembly of the glucocorticoid receptor/Hsp90/immunophilin heterocomplex. Wu, B., Li, P., Liu, Y. et al. Proc Natl Acad Sci U S A (2004) 101:8348-8353. DOI 10.1073/pnas.0305969101 · PubMed

Other PDB entries of the same protein (UniProt Q02790 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LAY 1.7 Å, Crystal Structure Analysis of FKBP52, Complex with I63
4DRJ 1.8 Å, o-crystal structure of the PPIase domain of FKBP52, Rapamycin and the FRB fragment of mTOR
4LAV 1.8 Å, Crystal Structure Analysis of FKBP52, Crystal Form II
1Q1C 1.9 Å, Crystal structure of N(1-260) of human FKBP52
4LAX 2.01 Å, Crystal Structure Analysis of FKBP52, Complex with FK506
6RCY 2.3 Å, Crystal structure of FK1 domain of FKBP52 in complex with a bio-inspired hybrid…
1N1A 2.4 Å, Crystal Structure of the N-terminal domain of human FKBP52
4LAW 2.4 Å, Crystal Structure Analysis of FKBP52, Crystal Form III
1P5Q 2.8 Å, Crystal Structure of FKBP52 C-terminal Domain
4TW8 3.0 Å, The Fk1-Fk2 domains of FKBP52 in complex with iFit-FL
8FFV 3.01 Å, Cryo-EM structure of the GR-Hsp90-FKBP52 complex

Browse structure collections

About this viewer

MolViewer shows 1QZ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.