Crystal Structure Analysis of FKBP52, Crystal Form II. Determined by X-ray diffraction at 1.8 Å resolution. Released 21 Aug 2013.
Explore 4LAV in 3D Show helices and sheets RCSB PDB PDBe
4LAV contains 20 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 17-20 | 4 | |
| β-strand | 24 | 1 | 1 |
| β-strand | 33-39 | 7 | 1 |
| α-helix | 47-48 | 2 | |
| β-strand | 52-61 | 10 | 1 |
| β-strand | 66-69 | 4 | 1 |
| β-strand | 77-80 | 4 | 1 |
| α-helix | 88-94 | 7 | |
| α-helix | 97-98 | 2 | |
| β-strand | 102-107 | 6 | 1 |
| α-helix | 109-111 | 3 | |
| β-strand | 118 | 1 | 2 |
| β-strand | 122 | 1 | 2 |
| β-strand | 128-138 | 11 | 1 |
| β-strand | 141 | 1 | 3 |
| β-strand | 150-156 | 7 | 3 |
| β-strand | 159 | 1 | 4 |
| β-strand | 169-178 | 10 | 3 |
| β-strand | 181-191 | 11 | 3 |
| α-helix | 195-198 | 4 | |
| α-helix | 202-208 | 7 | |
| β-strand | 213 | 1 | 4 |
| β-strand | 216-221 | 6 | 3 |
| α-helix | 223-225 | 3 | |
| β-strand | 232 | 1 | 5 |
| α-helix | 233-235 | 3 | |
| β-strand | 237 | 1 | 5 |
| α-helix | 238 | 1 | |
| β-strand | 243-253 | 11 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 17-20 | 4 | |
| β-strand | 24 | 1 | 6 |
| β-strand | 33-39 | 7 | 6 |
| β-strand | 52-61 | 10 | 6 |
| β-strand | 66-69 | 4 | 6 |
| β-strand | 77-80 | 4 | 6 |
| α-helix | 88-94 | 7 | |
| α-helix | 97-98 | 2 | |
| β-strand | 102-107 | 6 | 6 |
| α-helix | 109-111 | 3 | |
| β-strand | 128-138 | 11 | 6 |
| β-strand | 141 | 1 | 7 |
| β-strand | 150-156 | 7 | 7 |
| β-strand | 159 | 1 | 8 |
| α-helix | 164-165 | 2 | |
| β-strand | 169-178 | 10 | 7 |
| β-strand | 181-191 | 11 | 7 |
| α-helix | 195-198 | 4 | |
| α-helix | 202-208 | 7 | |
| β-strand | 213 | 1 | 8 |
| β-strand | 216-221 | 6 | 7 |
| α-helix | 223-225 | 3 | |
| β-strand | 232 | 1 | 9 |
| α-helix | 233-235 | 3 | |
| β-strand | 237 | 1 | 9 |
| α-helix | 238 | 1 | |
| β-strand | 243-253 | 11 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptidyl-prolyl cis-trans isomerase FKBP4 | A, B | protein | 246 | Homo sapiens | Q02790 (AlphaFold model) |
>4LAV_1 Peptidyl-prolyl cis-trans isomerase FKBP4 (chains A, B) GAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRK DKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVEL FEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGE GENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEK AKESWE
Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge. Bracher, A., Kozany, C., Hahle, A. et al. J Mol Biol (2013) 425:4134-4144. DOI 10.1016/j.jmb.2013.07.041 · PubMed
Other PDB entries of the same protein (UniProt Q02790 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4LAV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.