Crystal Structure of FKBP52 C-terminal Domain complex with the C-terminal peptide MEEVD of Hsp90. Determined by X-ray diffraction at 3.0 Å resolution. Released 22 Jun 2004.
Explore 1QZ2 in 3D Show helices and sheets RCSB PDB PDBe
1QZ2 contains 35 α-helices and 25 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 150-156 | 7 | 1 |
| β-strand | 169-178 | 10 | 1 |
| β-strand | 181-186 | 6 | 1 |
| β-strand | 189-191 | 3 | 1 |
| α-helix | 195-198 | 4 | |
| α-helix | 202-208 | 7 | |
| β-strand | 216-221 | 6 | 1 |
| α-helix | 223-225 | 3 | |
| β-strand | 232 | 1 | 2 |
| β-strand | 237 | 1 | 2 |
| β-strand | 243-253 | 11 | 1 |
| α-helix | 254-257 | 4 | |
| α-helix | 258-260 | 3 | |
| α-helix | 263-282 | 20 | |
| α-helix | 286-300 | 15 | |
| α-helix | 308-331 | 24 | |
| α-helix | 335-349 | 15 | |
| α-helix | 353-365 | 13 | |
| α-helix | 369-382 | 14 | |
| α-helix | 387-423 | 37 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 150-153 | 4 | 3 |
| β-strand | 169-171 | 3 | 4 |
| β-strand | 173 | 1 | 3 |
| β-strand | 176-177 | 2 | 3 |
| β-strand | 182-184 | 3 | 3 |
| β-strand | 189-191 | 3 | 4 |
| α-helix | 195-198 | 4 | |
| α-helix | 202-208 | 7 | |
| β-strand | 216-221 | 6 | 3 |
| α-helix | 223-225 | 3 | |
| α-helix | 228-230 | 3 | |
| α-helix | 233-235 | 3 | |
| β-strand | 243-248 | 6 | 3 |
| β-strand | 252-253 | 2 | 4 |
| α-helix | 258-260 | 3 | |
| α-helix | 263-282 | 20 | |
| α-helix | 286-299 | 14 | |
| α-helix | 309-332 | 24 | |
| α-helix | 335-348 | 14 | |
| α-helix | 353-365 | 13 | |
| α-helix | 369-382 | 14 | |
| α-helix | 387-423 | 37 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 150-152 | 3 | 5 |
| β-strand | 156 | 1 | 5 |
| β-strand | 169-177 | 9 | 5 |
| β-strand | 182-191 | 10 | 5 |
| α-helix | 195-198 | 4 | |
| α-helix | 202-209 | 8 | |
| β-strand | 216 | 1 | 5 |
| β-strand | 219-221 | 3 | 5 |
| β-strand | 243-245 | 3 | 5 |
| β-strand | 248-253 | 6 | 5 |
| α-helix | 258-260 | 3 | |
| α-helix | 263-282 | 20 | |
| α-helix | 286-299 | 14 | |
| α-helix | 309-331 | 23 | |
| α-helix | 335-346 | 12 | |
| α-helix | 353-365 | 13 | |
| α-helix | 369-382 | 14 | |
| α-helix | 387-422 | 36 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FK506-binding protein 4 | A, B, C | protein | 336 | Homo sapiens | Q02790 (AlphaFold model) |
| 5-mer peptide from Heat shock protein HSP 90 | G, H | protein | 5 | P08238 (AlphaFold model) |
>1QZ2_1 FK506-binding protein 4 (chains A, B, C) MGSSHHHHHHSSGLVPRGSHMEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLF DQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAEL KYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYE SSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAH LAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEEN KAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA
>1QZ2_2 5-mer peptide from Heat shock protein HSP 90 (chains G, H) MEEVD
3D structure of human FK506-binding protein 52: Implications for the assembly of the glucocorticoid receptor/Hsp90/immunophilin heterocomplex. Wu, B., Li, P., Liu, Y. et al. Proc Natl Acad Sci U S A (2004) 101:8348-8353. DOI 10.1073/pnas.0305969101 · PubMed
Other PDB entries of the same protein (UniProt Q02790 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1QZ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.