1R05: Max B-HLH-LZ

Name: PDB 1R05: Solution Structure of Max B-HLH-LZ
Published: 2003-10-21
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Solution Structure of Max B-HLH-LZ. Determined by solution NMR. Released 21 Oct 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,424
Mol. weight: 20.35 kDa
Released: 21 Oct 2003

Explore 1R05 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1R05 contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	18-29	12
α-helix	33-36	4
α-helix	42-49	8
α-helix	50-54	5
α-helix	55-82	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Max protein	A, B	protein	87	Homo sapiens	P61244 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1R05_1 Max protein (chains A, B)
MADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKVHT
LQQDIDDLKRQNALLEQQVRALEGSGC

Primary citation

The NMR solution structure of a mutant of the Max b/HLH/LZ free of DNA: insights into the specific and reversible DNA binding mechanism of dimeric transcription factors. Sauv, S., Tremblay, L., Lavigne, P. J Mol Biol (2004) 342:813-832. DOI 10.1016/j.jmb.2004.07.058 · PubMed

Other PDB entries of the same protein (UniProt P61244 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G6K 1.35 Å, The crystal structures of Human MYC:MAX bHLHZip complex
1NKP 1.8 Å, Crystal structure of Myc-Max recognizing DNA
1NLW 2.0 Å, Crystal structure of Mad-Max recognizing DNA
6G6L 2.2 Å, The crystal structures of Human MYC:MAX bHLHZip complex
6G6J 2.25 Å, The crystal structures of Human MYC:MAX bHLHZip complex
5EYO 2.39 Å, The crystal structure of the Max bHLH domain in complex with 5-carboxyl cytosine DNA
7RCU 2.69 Å, Synthetic Max homodimer mimic in complex with DNA
1HLO 2.8 Å, The crystal structure of an intact human max-DNA complex: new insights into mechanisms…
1AN2 2.9 Å, Recognition by max of its cognate DNA through a dimeric b/hlh/z domain
8OTS 3.3 Å, OCT4 and MYC-MAX co-bound to a nucleosome
8OTT 3.3 Å, MYC-MAX bound to a nucleosome at SHL+5.8

Browse structure collections

About this viewer

MolViewer shows 1R05 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.