1R2X: 50S ribosomal protein L11
Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of EF-Tu ternary complex (GDP.Kirromycin) bound 70S ribosome. Determined by electron microscopy at 9.0 Å resolution. Released 4 Nov 2003.
- Method
- Electron microscopy
- Resolution
- 9.0 Å
- Organism
- Thermotoga maritima
- Chains
- 2
- Atoms
- 190
- Mol. weight
- 33.8 kDa
- Released
- 4 Nov 2003
Explore 1R2X in 3D
Show helices and sheets
RCSB PDB
PDBe
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| 58nts of 23S rRNA | C | RNA | 58 | | |
| 50S ribosomal protein L11 | A | protein | 141 | Thermotoga maritima | P29395 (AlphaFold model) |
Sequence of entity 1 (C), FASTA
>1R2X_1 58nts of 23S rRNA (chains C)
GCUGGGAUGUUGGCUUAGAAGCAGCCAUCAUUUAAAGAGUGCGUAACAGCUCACCAGC
Sequence of entity 2 (A), FASTA
>1R2X_2 50S ribosomal protein L11 (chains A)
AKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVY
EDKSFTFIIKTEPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANS
LEAAMKIIEGTAKSMGIEVVD
Primary citation
Incorporation of aminoacyl-tRNA into the ribosome as seen by cryo-electron Microscopy. Valle, M., Zavialov, A., Li, W. et al. Nat Struct Biol (2003) 10:899-906. DOI 10.1038/nsb1003 · PubMed
Other PDB entries of the same protein (UniProt P29395 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1MMS 2.57 Å, Crystal structure of the ribosomal PROTEIN L11-RNA complex
- 4V42 5.5 Å, Crystal structure of the ribosome at 5.5 A resolution.
- 4V4R 5.9 Å, Crystal structure of the whole ribosomal complex.
- 4V4T 6.46 Å, Crystal structure of the whole ribosomal complex with a stop codon in the A-site.
- 4V4S 6.76 Å, Crystal structure of the whole ribosomal complex.
- 487D 7.5 Å, Seven ribosomal proteins fitted to a CRYO-electron microscopic map of the large 50S…
- 1R2W 9.0 Å, Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of the 70S ribosome
- 1PN7 10.8 Å, Coordinates of S12, L11 proteins and P-tRNA, from the 70S X-ray structure aligned to the…
- 1PN8 10.8 Å, Coordinates of S12, L11 proteins and E-site tRNA from 70S crystal structure separately…
- 2BCW 11.2 Å, Coordinates of the N-terminal domain of ribosomal protein L11,C-terminal domain of…
- 1EG0 11.5 Å, Fitting of components with known structure into an 11.5 a cryo-EM map of the e.coli 70S…
- 1MVR 12.8 Å, Decoding Center & Peptidyl transferase center from the X-ray structure of the Thermus…
Browse structure collections
About this viewer
MolViewer shows 1R2X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.