1R5S: Connexin 43 Carboxyl Terminal Domain

Connexin 43 Carboxyl Terminal Domain. Determined by solution NMR. Released 26 Oct 2004.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 997
Mol. weight: 14.22 kDa
Released: 26 Oct 2004

Explore 1R5S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1R5S contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	67-75	9
α-helix	92-98	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gap junction alpha-1 protein	A	protein	132	Rattus norvegicus	P08050 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1R5S_1 Gap junction alpha-1 protein (chains A)
GPLGSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNW
ANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSR
ASSRPRPDDLEI

Primary citation

Structural changes in the carboxyl terminus of the gap junction protein connexin43 indicates signaling between binding domains for c-Src and zonula occludens-1. Sorgen, P.L., Duffy, H.S., Sahoo, P. et al. J Biol Chem (2004) 279:54695-54701. DOI 10.1074/jbc.M409552200 · PubMed

Other PDB entries of the same protein (UniProt P08050 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CYY 2.4 Å, The crystal structure of ZO-1 PDZ2 in complex with the Cx43 peptide
2N8T Solution Structure of the rNedd4 WW2 Domain-Cx43CT Peptide Complex by NMR

Browse structure collections

About this viewer

MolViewer shows 1R5S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.