3CYY: ZO-1 PDZ2

The crystal structure of ZO-1 PDZ2 in complex with the Cx43 peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 23 Sept 2008.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,473
Mol. weight: 22.53 kDa
Released: 23 Sept 2008

Explore 3CYY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CYY contains 5 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	185-190	6	1
β-strand	200-211	12	1
α-helix	216-219	4
α-helix	227	1
β-strand	228-232	5	1
β-strand	235-236	2	1
α-helix	242-250	9
β-strand	255-261	7	1

Chain B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	185-190	6	1
β-strand	200-211	12	1
α-helix	216-220	5
β-strand	228-232	5	1
β-strand	235-236	2	1
α-helix	242-250	9
β-strand	255-261	7	1

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	7-8	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tight junction protein ZO-1	A, B	protein	92	Homo sapiens	Q07157 (AlphaFold model)
peptide from Gap junction alpha-1 protein	C, D	protein	9		P08050 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3CYY_1 Tight junction protein ZO-1 (chains A, B)
AKPTKVTLVKSAKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMS
LTDAKTLIERSKGKLKMVVQRDERATLLNVPD

Sequence of entity 2 (C, D), FASTA

>3CYY_2 peptide from Gap junction alpha-1 protein (chains C, D)
RPRPDDLEI

Primary citation

Domain-swapped dimerization of ZO-1 PDZ2 generates specific and regulatory connexin43-binding sites. Chen, J., Pan, L., Wei, Z. et al. EMBO J (2008) 27:2113-2123. DOI 10.1038/emboj.2008.138 · PubMed

Other PDB entries of the same protein (UniProt Q07157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q2Q 1.45 Å, ZO1 PDZ3 in Complex with a Phage-Derived Peptide
2H2B 1.6 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTYL)
2RCZ 1.7 Å, Structure of the second PDZ domain of ZO-1
9HM2 1.72 Å, A swapped dimeric form of ZO1/TJP1 PDZ2 in complex with the C-terminal peptide from…
4YYX 1.79 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin2 C-terminal…
4OEO 1.9 Å, High resolution crystal structure of the unliganded ZO-1 PDZ1 domain
3TSV 1.99 Å, crystal structure of the third PDZ domain of the human ZO-1 MAGUK protein
2H2C 2.0 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTWV)
4OEP 2.35 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin1 C-terminal…
3TSZ 2.5 Å, crystal structure of PDZ3-SH3-GUK core module from human ZO-1 in complex with 12mer…
3LH5 2.6 Å, Crystal Structure of the SH3-Guanylate kinase core domain of ZO-1
3SHU 2.75 Å, Crystal structure of ZO-1 PDZ3

Browse structure collections

About this viewer

MolViewer shows 3CYY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.