1RGS: Camp dependent protein kinase

Name: PDB 1RGS: Regulatory subunit of camp dependent protein kinase
Published: 1996-12-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: kinase

Regulatory subunit of camp dependent protein kinase. Determined by X-ray diffraction at 2.8 Å resolution. Released 7 Dec 1996.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Bos taurus
Chains: 1
Atoms: 2,059
Mol. weight: 33.15 kDa
Ligands: CMP
Released: 7 Dec 1996

Explore 1RGS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RGS contains 13 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	121-132	12
α-helix	134-136	3
α-helix	141-150	10
β-strand	152-156	5	1
β-strand	161-163	3	2
β-strand	171-177	7	1
β-strand	180-183	4	2
β-strand	190-192	3	2
β-strand	197-198	2	1
α-helix	200-205	6
β-strand	212-215	4	2
β-strand	219-225	7	1
α-helix	226-228	3
α-helix	229-233	5
α-helix	234-250	17
α-helix	252-256	5
α-helix	259-268	10
β-strand	270	1	3
β-strand	273-274	2	3
β-strand	279-281	3	4
β-strand	289-295	7	3
β-strand	298-302	5	4
β-strand	311-316	6	4
β-strand	321-322	2	3
α-helix	324-329	6
β-strand	336-339	4	4
β-strand	343-349	7	3
α-helix	350-356	7
α-helix	361-365	5
α-helix	368-370	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Camp dependent protein kinase	A	protein	288	Bos taurus	P00514 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RGS_1 CAMP DEPENDENT PROTEIN KINASE (chains A)
RRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAM
FPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAA
TVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEP
VQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNR
PRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV

Ligands and cofactors

ID	Name	Formula	Copies
CMP	Adenosine-3',5'-cyclic-monophosphate	C10 H12 N5 O6 P	2

Primary citation

Regulatory subunit of protein kinase A: structure of deletion mutant with cAMP binding domains. Su, Y., Dostmann, W.R., Herberg, F.W. et al. Science (1995) 269:807-813. PubMed

Other PDB entries of the same protein (UniProt P00514 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PNA 1.5 Å, Crystal Structure of cAMP bound (91-244)RIa Subunit of cAMP-dependent Protein Kinase
3FHI 2.0 Å, Crystal structure of a complex between the catalytic and regulatory (RI{alpha}) subunits…
3IM3 2.0 Å, Crystal structure of PKA RI alpha dimerization/docking domain
5HVZ 2.0 Å, Crystal structure of smAKAP AKB domain bound RIa dimerization/docking (D/D) complex at…
2QCS 2.2 Å, A complex structure between the Catalytic and Regulatory subunit of Protein Kinase A…
3IM4 2.29 Å, Crystal structure of cAMP-dependent Protein Kinase A Regulatory Subunit I alpha in…
1NE6 2.3 Å, Crystal structure of Sp-cAMP binding R1a subunit of cAMP-dependent protein kinase
3PLQ 2.3 Å, Crystal structure of PKA type I regulatory subunit bound with Rp-8-Br-cAMPS
1NE4 2.4 Å, Crystal Structure of Rp-cAMP Binding R1a Subunit of cAMP-dependent Protein Kinase
4X6R 2.4 Å, An Isoform-specific Myristylation Switch Targets RIIb PKA Holoenzymes to Membranes
1RL3 2.7 Å, Crystal structure of cAMP-free R1a subunit of PKA
3IIA 2.7 Å, Crystal structure of apo (91-244) RIa subunit of cAMP-dependent protein kinase

Browse structure collections

About this viewer

MolViewer shows 1RGS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.