3IM4: PDB entry 3IM4

Crystal structure of cAMP-dependent Protein Kinase A Regulatory Subunit I alpha in complex with dual-specific A-Kinase Anchoring Protein 2. Determined by X-ray diffraction at 2.29 Å resolution. Released 2 Feb 2010.

Method: X-ray diffraction
Resolution: 2.29 Å
Organisms: Bos taurus, Homo sapiens
Chains: 3
Atoms: 1,058
Mol. weight: 17.43 kDa
Ligands: ZN
Released: 2 Feb 2010

Explore 3IM4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IM4 contains 7 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	13-22	10
α-helix	25-39	15
α-helix	44-58	15

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	13-22	10
α-helix	25-39	15
α-helix	44-57	14

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	629-653	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type I-alpha regulatory subunit	A, B	protein	50	Bos taurus	P00514 (AlphaFold model)
Dual specificity A kinase-anchoring protein 2	C	protein	45	Homo sapiens	O43572 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3IM4_1 cAMP-dependent protein kinase type I-alpha regulatory subunit (chains A, B)
SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK

Sequence of entity 2 (C), FASTA

>3IM4_2 Dual specificity A kinase-anchoring protein 2 (chains C)
GSPEFVQGNTDEAQEELAWKIAKMIVSDVMQQAQYDQPLEKSTKL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	5

Primary citation

Structure of D-AKAP2:PKA RI Complex: Insights into AKAP Specificity and Selectivity. Sarma, G.N., Kinderman, F.S., Kim, C. et al. Structure (2010) 18:155-166. DOI 10.1016/j.str.2009.12.012 · PubMed

Other PDB entries of the same protein (UniProt P00514 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PNA 1.5 Å, Crystal Structure of cAMP bound (91-244)RIa Subunit of cAMP-dependent Protein Kinase
3FHI 2.0 Å, Crystal structure of a complex between the catalytic and regulatory (RI{alpha}) subunits…
3IM3 2.0 Å, Crystal structure of PKA RI alpha dimerization/docking domain
5HVZ 2.0 Å, Crystal structure of smAKAP AKB domain bound RIa dimerization/docking (D/D) complex at…
2QCS 2.2 Å, A complex structure between the Catalytic and Regulatory subunit of Protein Kinase A…
1NE6 2.3 Å, Crystal structure of Sp-cAMP binding R1a subunit of cAMP-dependent protein kinase
3PLQ 2.3 Å, Crystal structure of PKA type I regulatory subunit bound with Rp-8-Br-cAMPS
1NE4 2.4 Å, Crystal Structure of Rp-cAMP Binding R1a Subunit of cAMP-dependent Protein Kinase
4X6R 2.4 Å, An Isoform-specific Myristylation Switch Targets RIIb PKA Holoenzymes to Membranes
1RL3 2.7 Å, Crystal structure of cAMP-free R1a subunit of PKA
3IIA 2.7 Å, Crystal structure of apo (91-244) RIa subunit of cAMP-dependent protein kinase
1RGS 2.8 Å, Regulatory subunit of camp dependent protein kinase

Browse structure collections

About this viewer

MolViewer shows 3IM4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.