3IIA: PDB entry 3IIA

Crystal structure of apo (91-244) RIa subunit of cAMP-dependent protein kinase. Determined by X-ray diffraction at 2.7 Å resolution. Released 11 Aug 2010.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Bos taurus
Chains: 1
Atoms: 1,071
Mol. weight: 17.43 kDa
Released: 11 Aug 2010

Explore 3IIA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IIA contains 7 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	120-130	11
α-helix	142-150	9
β-strand	151-156	6	1
β-strand	161	1	2
β-strand	165	1	3
β-strand	167	1	3
α-helix	168-169	2
β-strand	171-177	7	1
β-strand	180-184	5	2
β-strand	187-190	4	2
β-strand	197-198	2	1
α-helix	201-205	5
β-strand	212-215	4	2
β-strand	219-225	7	1
α-helix	226-229	4
α-helix	230-234	5
α-helix	235-241	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type I-alpha regulatory subunit	A	protein	154	Bos taurus	P00514 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3IIA_1 cAMP-dependent protein kinase type I-alpha regulatory subunit (chains A)
GRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDA
MFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRA
ATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMY

Primary citation

Cyclic AMP analog blocks kinase activation by stabilizing inactive conformation: conformational selection highlights a new concept in allosteric inhibitor design. Badireddy, S., Yunfeng, G., Ritchie, M. et al. Mol Cell Proteomics (2011) 10:M110.004390-M110.004390. DOI 10.1074/mcp.M110.004390 · PubMed

Other PDB entries of the same protein (UniProt P00514 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PNA 1.5 Å, Crystal Structure of cAMP bound (91-244)RIa Subunit of cAMP-dependent Protein Kinase
3FHI 2.0 Å, Crystal structure of a complex between the catalytic and regulatory (RI{alpha}) subunits…
3IM3 2.0 Å, Crystal structure of PKA RI alpha dimerization/docking domain
5HVZ 2.0 Å, Crystal structure of smAKAP AKB domain bound RIa dimerization/docking (D/D) complex at…
2QCS 2.2 Å, A complex structure between the Catalytic and Regulatory subunit of Protein Kinase A…
3IM4 2.29 Å, Crystal structure of cAMP-dependent Protein Kinase A Regulatory Subunit I alpha in…
1NE6 2.3 Å, Crystal structure of Sp-cAMP binding R1a subunit of cAMP-dependent protein kinase
3PLQ 2.3 Å, Crystal structure of PKA type I regulatory subunit bound with Rp-8-Br-cAMPS
1NE4 2.4 Å, Crystal Structure of Rp-cAMP Binding R1a Subunit of cAMP-dependent Protein Kinase
4X6R 2.4 Å, An Isoform-specific Myristylation Switch Targets RIIb PKA Holoenzymes to Membranes
1RL3 2.7 Å, Crystal structure of cAMP-free R1a subunit of PKA
1RGS 2.8 Å, Regulatory subunit of camp dependent protein kinase

Browse structure collections

About this viewer

MolViewer shows 3IIA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.