1RH2: Recombinant human interferon-alpha 2B
Recombinant human interferon-alpha 2B. Determined by X-ray diffraction at 2.9 Å resolution. Released 12 Nov 1997.
- Method
- X-ray diffraction
- Resolution
- 2.9 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 791
- Mol. weight
- 115.92 kDa
- Ligands
- ZN
- Released
- 12 Nov 1997
Explore 1RH2 in 3D
Show helices and sheets
RCSB PDB
PDBe
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Interferon-alpha 2B | A, B, C, D, E, F | protein | 165 | Homo sapiens | P01563 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>1RH2_1 INTERFERON-ALPHA 2B (chains A, B, C, D, E, F)
CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 4 |
Primary citation
Zinc mediated dimer of human interferon-alpha 2b revealed by X-ray crystallography. Radhakrishnan, R., Walter, L.J., Hruza, A. et al. Structure (1996) 4:1453-1463. DOI 10.1016/S0969-2126(96)00152-9 · PubMed
Other PDB entries of the same protein (UniProt P01563 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9GVO 1.81 Å, type-I interferons autoantibodies pmab15 and pmab14 in complex with Interferon alpha-2
- 3S9D 2.0 Å, binary complex between IFNa2 and IFNAR2
- 9GVL 2.01 Å, type-I interferons autoantibody pmab15 in complex with Interferon alpha-2
- 4YPG 3.0 Å, Structural Insights Into the Neutralization Properties of a Human Anti-Interferon…
- 4Z5R 3.0 Å, Rontalizumab Fab bound to Interferon-a2
- 9GW5 4.0 Å, type-I interferon autoantibodies pmab3, pmab19 and pmab14 in complex with Interferon…
- 3SE3 4.0 Å, human IFNa2-IFNAR ternary complex
- 1ITF Interferon alpha-2A, NMR, 24 structures
- 2HYM NMR based Docking Model of the Complex between the Human Type I Interferon Receptor and…
- 2KZ1 Inter-molecular interactions in a 44 kDa interferon-receptor complex detected by…
- 2LAG Structure of the 44 kDa complex of interferon-alpha2 with the extracellular part of…
- 2LMS A single GalNAc residue on Threonine-106 modifies the dynamics and the structure of…
Browse structure collections
About this viewer
MolViewer shows 1RH2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.