9GVL: Type-I interferons autoantibody pmab15

type-I interferons autoantibody pmab15 in complex with Interferon alpha-2. Determined by X-ray diffraction at 2.01 Å resolution. Released 8 Oct 2025.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,953
Mol. weight: 105.15 kDa
Released: 8 Oct 2025

Explore 9GVL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GVL contains 30 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	9-21	13
α-helix	26-32	7
α-helix	40-42	3
α-helix	52-67	16
α-helix	70-75	6
α-helix	78-95	18
α-helix	114-132	19
α-helix	137-154	18

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	9-21	13
α-helix	26-32	7
α-helix	53-67	15
α-helix	70-75	6
α-helix	78-98	21
α-helix	114-132	19
α-helix	137-154	18

Chain H: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	1
β-strand	13-14	2	2
β-strand	20-27	8	1
α-helix	31-33	3
β-strand	36-41	6	3
β-strand	48-53	6	3
β-strand	60-62	3	3
β-strand	67	1	1
β-strand	70-75	6	1
α-helix	76-78	3
β-strand	80-85	6	1
α-helix	90-92	3
β-strand	94-101	8	3
β-strand	113-116	4	3
β-strand	120-122	3	3
β-strand	123-124	2	2
β-strand	150-153	4	4
β-strand	156-158	3	3
β-strand	165-171	7	4
α-helix	176-178	3
β-strand	180-185	6	3
β-strand	192-196	5	3
β-strand	200-201	2	3
α-helix	202	1
β-strand	209-214	6	4
β-strand	217-222	6	4
α-helix	227-229	3
β-strand	231-237	7	3
α-helix	243-244	2
β-strand	245-246	2	3
β-strand	250-253	4	3

Chain I: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	5
β-strand	13-14	2	6
β-strand	20-27	8	5
α-helix	31-33	3
β-strand	36-41	6	7
β-strand	48-53	6	7
β-strand	60-62	3	7
β-strand	67	1	5
β-strand	70-75	6	5
α-helix	76-78	3
β-strand	80-85	6	5
α-helix	90-92	3
β-strand	94-101	8	7
β-strand	113-116	4	7
β-strand	120-122	3	7
β-strand	123-124	2	6
β-strand	150-153	4	8
β-strand	156-158	3	7
β-strand	165-171	7	8
α-helix	176-178	3
β-strand	180-185	6	7
α-helix	190-191	2
β-strand	192-196	5	7
β-strand	200-201	2	7
α-helix	202	1
β-strand	209-214	6	8
β-strand	217-222	6	8
α-helix	227-229	3
β-strand	232-237	6	7
α-helix	243-244	2
β-strand	245-246	2	7
β-strand	250-253	4	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon alpha-2	A, B	protein	188	Homo sapiens	P01563 (AlphaFold model)
scFv type-I interferons autoantibody pmab15	H, I	protein	294	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>9GVL_1 Interferon alpha-2 (chains A, B)
CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKEGGGGSLVPRGSGGGS
HHHHHHHH

Sequence of entity 2 (H, I), FASTA

>9GVL_2 scFv type-I interferons autoantibody pmab15 (chains H, I)
RSEVQLVESGGDLVQPGGSLRLSCAASGFTFSGYAMAWVRQAPGKEMQWVSSISDDGGTS
YYADSVEGRFTVSRDNSRSSLYLQINNLRAGDTAVYHCARDHGGNDYGDFGHFDLWGRGT
LVTVSSGTGGSGGGGSGGGGSGGGASEIVLTQSPGTLSLSPGEGATLSCRASQRVSNNYL
AWYQHRPGQAPRLLIYGASSRATGIPDRFRGSGSGTDFTLTISRLEPEDFAVYFCQQYGS
APPWTFGQGTKVEIKGPFEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Primary citation

Temporal and structural insights into type-I interferons autoantibodies in severe COVID-19. Vanderkerken, M., Fournier, M., Dorgham, K. et al. To be published.

Other PDB entries of the same protein (UniProt P01563 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GVO 1.81 Å, type-I interferons autoantibodies pmab15 and pmab14 in complex with Interferon alpha-2
3S9D 2.0 Å, binary complex between IFNa2 and IFNAR2
1RH2 2.9 Å, Recombinant human interferon-alpha 2B
4YPG 3.0 Å, Structural Insights Into the Neutralization Properties of a Human Anti-Interferon…
4Z5R 3.0 Å, Rontalizumab Fab bound to Interferon-a2
9GW5 4.0 Å, type-I interferon autoantibodies pmab3, pmab19 and pmab14 in complex with Interferon…
3SE3 4.0 Å, human IFNa2-IFNAR ternary complex
1ITF Interferon alpha-2A, NMR, 24 structures
2HYM NMR based Docking Model of the Complex between the Human Type I Interferon Receptor and…
2KZ1 Inter-molecular interactions in a 44 kDa interferon-receptor complex detected by…
2LAG Structure of the 44 kDa complex of interferon-alpha2 with the extracellular part of…
2LMS A single GalNAc residue on Threonine-106 modifies the dynamics and the structure of…

Browse structure collections

About this viewer

MolViewer shows 9GVL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.