1ROD: PDB entry 1ROD

Chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, NMR. Determined by solution NMR. Released 10 Jun 1996.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,136
Mol. weight: 16.31 kDa
Released: 10 Jun 1996

Explore 1ROD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ROD contains 4 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	19-21	3
β-strand	22-24	3	1
β-strand	28	1	2
β-strand	39-41	3	3
β-strand	42-43	2	1
β-strand	49-51	3	3
α-helix	57-69	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein	A, B	protein	72	Homo sapiens	P09341 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1ROD_1 CHIMERIC PROTEIN OF INTERLEUKIN 8 AND HUMAN MELANOMA GROWTH STIMULATING ACTIVITY PROTEIN (chains A, B)
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPASPIVKK
IIEKMLNSDKSN

Primary citation

Structure and activity of a chimeric interleukin-8-melanoma-growth-stimulatory-activity protein. Sticht, H., Auer, M., Schmitt, B. et al. Eur J Biochem (1996) 235:26-35. DOI 10.1111/j.1432-1033.1996.00026.x · PubMed

Other PDB entries of the same protein (UniProt P09341 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9EJC 2.98 Å, Cryo-EM Structure of CXCL1-KSHV ORF74-Gi-scFv16 Complex
8K4O 3.01 Å, Cryo-EM structure of Kaposi's Sarcoma-Associated Herpesvirus-G Protein-Coupled Receptor…
8XWV 3.07 Å, Structure of CXCR2 bound to CXCL1 (CXCR2-CXCL1-Go Full map)
8XWA 3.48 Å, Structure of CXCR2 bound to CXCL1 (Ligand-receptor focused map)
1MGS The solution structure of melanoma growth stimulating activity
1MSG Solution structure of gro(slash)melanoma growth stimulatory activity determined by 1H…
1MSH Solution structure of gro(slash)melanoma growth stimulatory activity determined by 1H…

Browse structure collections

About this viewer

MolViewer shows 1ROD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.