1RPQ: High Affinity IgE Receptor

High Affinity IgE Receptor (alpha chain) Complexed with Tight-Binding E131 'zeta' Peptide from Phage Display. Determined by X-ray diffraction at 3.0 Å resolution. Released 20 Jul 2004.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 8
Atoms: 6,757
Mol. weight: 101.57 kDa
Ligands: CIT, NAG
Released: 20 Jul 2004

Explore 1RPQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RPQ contains 32 α-helices and 80 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and D: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
β-strand	15-17	3	2
β-strand	22-26	5	1
β-strand	38-41	4	3
β-strand	44-45	2	3
α-helix	46	1
β-strand	52-55	4	1
α-helix	60-62	3
β-strand	64-69	6	3
β-strand	75	1	3
α-helix	76-78	3
β-strand	79-81	3	3
β-strand	82-84	3	2
β-strand	88-92	5	4
β-strand	96-98	3	5
β-strand	103-109	7	4
α-helix	110-112	3
β-strand	116-122	7	6
β-strand	125-132	8	6
β-strand	136-138	3	4
α-helix	143-145	3
β-strand	147-155	9	6
β-strand	158-161	4	6
α-helix	162-164	3
β-strand	165-167	3	6
β-strand	168-170	3	5

Chain C: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	13
β-strand	15-17	3	14
β-strand	22-26	5	13
β-strand	38-41	4	15
β-strand	44-45	2	15
α-helix	46	1
β-strand	52-55	4	13
α-helix	60-62	3
β-strand	64-69	6	15
β-strand	75	1	15
α-helix	76-78	3
β-strand	79-81	3	15
β-strand	82-84	3	14
β-strand	88-92	5	16
β-strand	96-98	3	17
β-strand	103-109	7	16
α-helix	110-112	3
β-strand	115-122	8	18
β-strand	125-132	8	18
β-strand	136-138	3	16
α-helix	143-145	3
β-strand	147-155	9	18
β-strand	158-161	4	18
α-helix	162-164	3
β-strand	165-167	3	18
β-strand	168-170	3	17

Chain W: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
α-helix	17-19	3

Chain X: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	17-19	3

Chain Y: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	17-20	4

Chain Z: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
α-helix	17-19	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
High affinity immunoglobulin epsilon receptor alpha-subunit precursor	A, B, C, D	protein	176	Homo sapiens	P12319 (AlphaFold model)
Peptide E131	W, X, Y, Z	protein	21

Sequence of entity 1 (A, B, C, D), FASTA

>1RPQ_1 High affinity immunoglobulin epsilon receptor alpha-subunit precursor (chains A, B, C, D)
VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKF
EDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIY
YKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREK

Sequence of entity 2 (W, X, Y, Z), FASTA

>1RPQ_2 Peptide E131 (chains W, X, Y, Z)
VQCPHFCYELDYELCPDVCYV

Ligands and cofactors

ID	Name	Formula	Copies
CIT	Citric acid	C6 H8 O7	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Water and common crystallization additives (SO4) are not listed.

Primary citation

Convergent Recognition of the IgE Binding Site on the High-Affinity IgE Receptor. Stamos, J., Eigenbrot, C., Nakamura, G.R. et al. Structure (2004) 12:1289-1301. DOI 10.1016/j.str.2004.04.015 · PubMed

Other PDB entries of the same protein (UniProt P12319 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F2Q 2.4 Å, Crystal structure of the human high-affinity IgE receptor
8YWA 3.14 Å, The structure of IgE receptor binding to IgE
1J86 3.2 Å, Human high affinity fc receptor fc(epsilon)ri(alpha), monoclinic crystal form 2
1J87 3.2 Å, Human high affinity fc receptor fc(epsilon)ri(alpha), hexagonal crystal form 1
1J88 3.2 Å, Human high affinity fc receptor fc(epsilon)ri(alpha), tetragonal crystal form 1
2Y7Q 3.4 Å, The high-affinity complex between IgE and its receptor fc epsilon ri
1F6A 3.5 Å, Structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)
8K7R 3.56 Å, Human Fc epsilon RI in complex with hIgE Fc (TMD disordered)
8Z0T 3.58 Å, Structure of the human ige-fc bound to its high affinity receptor fc(epsilon)
8C1B 3.8 Å, Focused map for structure of IgE bound to the ectodomain of FceRIa
8YVU 3.9 Å, structure of Ige receptor
1J89 4.1 Å, Human high affinity fc receptor fc(epsilon)ri(alpha), tetragonal crystal form 2

Browse structure collections

About this viewer

MolViewer shows 1RPQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.