1RSO: Presynaptic protein SAP97

Hetero-tetrameric L27 (Lin-2, Lin-7) domain complexes as organization platforms of supra-molecular assemblies. Determined by solution NMR. Released 4 May 2004.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 4
Atoms: 1,908
Mol. weight: 27.13 kDa
Released: 4 May 2004

Explore 1RSO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RSO contains 12 α-helices and 2 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	8-23	16
α-helix	31-45	15
α-helix	47-55	9
β-strand	59-63	5	1

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	87-101	15
α-helix	107-118	12
α-helix	120-133	14

Chain C: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	8-23	16
α-helix	31-45	15
α-helix	47-56	10
β-strand	59-63	5	1

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	84-101	18
α-helix	107-118	12
α-helix	120-135	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Presynaptic protein SAP97	A, C	protein	60	Rattus norvegicus	Q62696 (AlphaFold model)
Peripheral plasma membrane protein CASK	B, D	protein	56	Rattus norvegicus	Q62915 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1RSO_1 Presynaptic protein SAP97 (chains A, C)
RKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTLLDN

Sequence of entity 2 (B, D), FASTA

>1RSO_2 Peripheral plasma membrane protein CASK (chains B, D)
GLLAAERAVSQVLDSLEEIHALTDSSEKDLDFLHSVFQDQHLHTLLDLYDKINTKS

Primary citation

The tetrameric L27 domain complex as an organization platform for supramolecular assemblies. Feng, W., Long, J.-F., Fan, J.-S. et al. Nat Struct Mol Biol (2004) 11:475-480. DOI 10.1038/nsmb751 · PubMed

Other PDB entries of the same protein (UniProt Q62696 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2AWX 1.8 Å, Synapse associated protein 97 PDZ2 domain variant C378S
2AWW 2.21 Å, Synapse associated protein 97 PDZ2 domain variant C378G with C-terminal GluR-A peptide
2I0L 2.31 Å, X-ray crystal structure of Sap97 PDZ2 bound to the C-terminal peptide of HPV18 E6.
2G2L 2.35 Å, Crystal Structure of the Second PDZ Domain of SAP97 in Complex with a GluR-A C-terminal…
2AWU 2.44 Å, Synapse associated protein 97 PDZ2 domain variant C378G
3UAT 2.7 Å, Guanylate Kinase Domains of the MAGUK Family Scaffold Proteins as Specific…
2I0I 2.8 Å, X-ray crystal structure of Sap97 PDZ3 bound to the C-terminal peptide of HPV18 E6
1ZOK PDZ1 Domain Of Synapse Associated Protein 97

Browse structure collections

About this viewer

MolViewer shows 1RSO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.