1RU7: 1934 Human H1 Hemagglutinin

1934 Human H1 Hemagglutinin. Determined by X-ray diffraction at 2.3 Å resolution. Released 30 Mar 2004.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Influenza A virus (A/Puerto Rico/8/34(H1N1))
Chains: 12
Atoms: 24,314
Mol. weight: 329.94 kDa
Released: 30 Mar 2004

Explore 1RU7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RU7 contains 72 α-helices and 311 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	1
β-strand	9-11	3	2
β-strand	12	1	3
β-strand	19-20	2	4
β-strand	28-29	2	4
β-strand	30	1	5
β-strand	33-35	3	6
β-strand	37-38	2	7
β-strand	45-48	4	8
β-strand	51	1	8
α-helix	52-53	2
β-strand	54-57	4	9
β-strand	59	1	10
α-helix	61-66	6
α-helix	69-74	6
β-strand	79	1	11
β-strand	83-85	3	9
β-strand	91	1	10
β-strand	99	1	11
α-helix	102-109	8
β-strand	112-119	8	11
α-helix	123-126	4
β-strand	131	1	12
β-strand	136-141	6	13
β-strand	144-146	3	13
β-strand	151-153	3	11
β-strand	155	1	12
β-strand	157	1	14
β-strand	160	1	14
α-helix	162-163	2
β-strand	164-169	6	15
β-strand	175-184	10	11
α-helix	188-195	8
β-strand	202-205	4	15
β-strand	210-213	4	15
β-strand	223	1	16
β-strand	226	1	16
β-strand	229-237	9	11
α-helix	238	1
β-strand	242-247	6	15
β-strand	251-254	4	11
β-strand	256-262	7	11
β-strand	268-270	3	9
α-helix	273-274	2
β-strand	275-280	6	8
β-strand	282-284	3	17
β-strand	287-288	2	17
β-strand	295-296	2	7
β-strand	302-306	5	18
α-helix	307	1
β-strand	308-309	2	7
β-strand	316-318	3	6
β-strand	322	1	5

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	506	1	19
β-strand	510	1	19
β-strand	514	1	3
β-strand	522-524	3	2
β-strand	527	1	1
β-strand	528	1	20
β-strand	531	1	20
β-strand	535-536	2	2
α-helix	538-558	21
α-helix	560-561	2
β-strand	562-565	4	18
α-helix	575-626	52
β-strand	630-632	3	1
β-strand	637-640	4	1
α-helix	646-653	8

Chain C: 7 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	21
β-strand	19-20	2	22
β-strand	28-29	2	22
β-strand	30	1	23
β-strand	33-35	3	24
β-strand	37-38	2	25
β-strand	45-48	4	26
β-strand	51	1	26
α-helix	52-53	2
β-strand	54-57	4	27
β-strand	59	1	28
α-helix	61-66	6
α-helix	69-74	6
β-strand	79	1	29
β-strand	83-85	3	27
β-strand	91	1	28
β-strand	99	1	29
α-helix	102-109	8
β-strand	112-119	8	29
α-helix	123-126	4
β-strand	131	1	30
β-strand	136-141	6	31
β-strand	144-146	3	31
β-strand	151-153	3	29
β-strand	155	1	30
β-strand	157	1	32
β-strand	160	1	32
β-strand	164-169	6	33
β-strand	176-184	9	29
α-helix	188-195	8
β-strand	202-205	4	33
β-strand	210-213	4	33
β-strand	223	1	34
β-strand	226	1	34
β-strand	229-237	9	29
β-strand	242-247	6	33
β-strand	251-254	4	29
β-strand	256-262	7	29
β-strand	268-270	3	27
β-strand	275-280	6	26
β-strand	282-283	2	35
β-strand	288	1	35
β-strand	295-296	2	25
β-strand	302-306	5	36
α-helix	307	1
β-strand	308-309	2	25
β-strand	316-318	3	24
β-strand	322	1	23

Chain D: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	506	1	37
β-strand	510	1	37
β-strand	513-514	2	21
β-strand	522-527	6	21
β-strand	532-536	5	21
α-helix	538-558	21
α-helix	560-561	2
β-strand	562-565	4	36
α-helix	575-626	52
β-strand	630-632	3	21
β-strand	637-640	4	21
α-helix	646-653	8

Chain E: 8 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	38
β-strand	9-11	3	39
β-strand	12	1	40
β-strand	19-20	2	41
β-strand	28-29	2	41
β-strand	30	1	42
β-strand	33-35	3	43
β-strand	37-38	2	44
β-strand	45-48	4	45
β-strand	51	1	45
α-helix	52-53	2
β-strand	54-57	4	46
β-strand	59	1	47
α-helix	61-66	6
α-helix	69-74	6
β-strand	79	1	48
β-strand	83-85	3	46
β-strand	91	1	47
β-strand	99	1	48
α-helix	102-109	8
β-strand	112-119	8	48
α-helix	123-126	4
β-strand	131	1	49
β-strand	136-141	6	50
β-strand	144-146	3	50
β-strand	151-153	3	48
β-strand	155	1	49
β-strand	157	1	51
β-strand	160	1	51
β-strand	164-169	6	52
β-strand	175-184	10	48
α-helix	188-195	8
β-strand	202-205	4	52
β-strand	210-213	4	52
β-strand	223	1	53
β-strand	226	1	53
β-strand	229-237	9	48
β-strand	242-247	6	52
β-strand	251-254	4	48
β-strand	256-262	7	48
β-strand	268-270	3	46
α-helix	273-274	2
β-strand	275-280	6	45
β-strand	282-283	2	54
β-strand	288-289	2	54
β-strand	295-296	2	44
β-strand	302-306	5	55
α-helix	307	1
β-strand	308-309	2	44
β-strand	316-318	3	43
β-strand	322	1	42

Chain F: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	506	1	56
β-strand	510	1	56
β-strand	514	1	40
β-strand	522-524	3	39
β-strand	527-528	2	38
β-strand	531-532	2	38
β-strand	535-536	2	39
α-helix	538-558	21
β-strand	562-565	4	55
α-helix	575-626	52
α-helix	627-629	3
β-strand	630-632	3	38
β-strand	637-640	4	38
α-helix	646-653	8

Chain G: 8 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	57
β-strand	9-11	3	58
β-strand	12	1	59
β-strand	19-20	2	60
β-strand	28-29	2	60
β-strand	30	1	61
β-strand	33-35	3	62
β-strand	37-38	2	63
β-strand	45-48	4	64
β-strand	51	1	64
α-helix	52-53	2
β-strand	54-57	4	65
β-strand	59	1	66
α-helix	61-66	6
α-helix	69-74	6
β-strand	79	1	67
β-strand	83-85	3	65
β-strand	91	1	66
β-strand	99	1	67
α-helix	102-109	8
β-strand	112-119	8	67
α-helix	123-126	4
β-strand	131	1	68
β-strand	136-141	6	69
β-strand	144-146	3	69
β-strand	151-153	3	67
β-strand	155	1	68
β-strand	157	1	70
β-strand	160	1	70
β-strand	164-169	6	71
β-strand	175-184	10	67
α-helix	188-195	8
β-strand	202-205	4	71
β-strand	210-213	4	71
β-strand	223	1	72
β-strand	226	1	72
β-strand	229-237	9	67
β-strand	242-247	6	71
β-strand	251-254	4	67
β-strand	256-262	7	67
β-strand	268-270	3	65
α-helix	273-274	2
β-strand	275-280	6	64
β-strand	282-284	3	73
β-strand	287-288	2	73
β-strand	295-296	2	63
β-strand	302-306	5	74
α-helix	307	1
β-strand	308-309	2	63
β-strand	316-318	3	62
β-strand	322	1	61

Chain H: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	506	1	75
β-strand	510	1	75
β-strand	514	1	59
β-strand	522-524	3	58
β-strand	527	1	57
β-strand	528	1	76
β-strand	531	1	76
β-strand	535-536	2	58
α-helix	538-558	21
β-strand	562-565	4	74
α-helix	575-626	52
β-strand	630-632	3	57
β-strand	637-640	4	57
α-helix	646-653	8

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
hemagglutinin	A, C, E, G, I, K	protein	327	Influenza A virus (A/Puerto Rico/8/34(H1N1))	P03452 (AlphaFold model)
hemagglutinin	B, D, F, H, J, L	protein	160	Influenza A virus (A/Puerto Rico/8/34(H1N1))	P03452 (AlphaFold model)

Sequence of entity 1 (A, C, E, G, I, K), FASTA

>1RU7_1 hemagglutinin (chains A, C, E, G, I, K)
ADADDTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRLKGIAPLQLGKCN
IAGWLLGNPECDPLLPVRSWSYIVETPNSENGICYPGDFIDYEELREQLSSVSSFERFEI
FPKESSWPNHNTNGVTAACSHEGKSSFYRNLLWLTEKEGSYPKLKNSYVNKKGKEVLVLW
GIHHPPNSKEQQNLYQNENAYVSVVTSNYNRRFTPEIAERPKVRDQAGRMNYYWTLLKPG
DTIIFEANGNLIAPMYAFALRRGFGSGIITSNASMHECNTKCQTPLGAINSSLPYQNIHP
VTIGECPKYVRSAKLRMVTGLRNIPAR

Sequence of entity 2 (B, D, F, H, J, L), FASTA

>1RU7_2 hemagglutinin (chains B, D, F, H, J, L)
GLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVIEKMN
IQFTAVGKEFNKLEKRMENLNNKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVKNLYE
KVKSQLKNNAKEIGNGCFEFYHKCDNECMESVRNGTYDYP

Primary citation

The structure and receptor binding properties of the 1918 influenza hemagglutinin. Gamblin, S.J., Haire, L.F., Russell, R.J. et al. Science (2004) 303:1838-1842. DOI 10.1126/science.1093155 · PubMed

Other PDB entries of the same protein (UniProt P03452 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9PHD 1.59 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
5VLI 1.8 Å, Computationally designed inhibitor peptide HB1.6928.2.3 in complex with influenza…
9PHS 2.02 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
8VQQ 2.05 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
1RVX 2.2 Å, 1934 H1 Hemagglutinin in complex with LSTA
8VQM 2.21 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
8VQN 2.21 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
1RVZ 2.25 Å, 1934 H1 Hemagglutinin in complex with LSTC
5W5S 2.28 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
8VQL 2.29 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
9PIB 2.35 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
9DXX 2.37 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…

Browse more

1RU7 is part of these collections:

Viruses

About this viewer

MolViewer shows 1RU7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.