9PHS: Hemagglutinin
Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in complex with fusion inhibitor cyclic peptide CP141085 (CP1). Determined by X-ray diffraction at 2.02 Å resolution. Released 24 Dec 2025.
- Method
- X-ray diffraction
- Resolution
- 2.02 Å
- Organisms
- Influenza A virus (A/Puerto Rico/8/1934(H1N1)), synthetic construct
- Chains
- 9
- Atoms
- 12,840
- Mol. weight
- 179.97 kDa
- Ligands
- CA, NAG
- Released
- 24 Dec 2025
Explore 9PHS in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9PHS contains 41 α-helices and 165 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 9 helices, 44 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 12-17 | 6 | 1 |
| β-strand | 18 | 1 | 2 |
| β-strand | 25-26 | 2 | 3 |
| β-strand | 34-35 | 2 | 3 |
| β-strand | 36 | 1 | 4 |
| β-strand | 39-41 | 3 | 5 |
| β-strand | 43-44 | 2 | 6 |
| β-strand | 50-54 | 5 | 7 |
| β-strand | 56 | 1 | 7 |
| α-helix | 57-58 | 2 | |
| β-strand | 59-62 | 4 | 8 |
| β-strand | 64 | 1 | 9 |
| α-helix | 66-71 | 6 | |
| α-helix | 74-79 | 6 | |
| β-strand | 83A | 1 | 10 |
| β-strand | 87-89 | 3 | 8 |
| β-strand | 95 | 1 | 9 |
| β-strand | 102 | 1 | 10 |
| α-helix | 105-112 | 8 | |
| β-strand | 115-122 | 8 | 10 |
| α-helix | 125A-126 | 4 | |
| β-strand | 131 | 1 | 11 |
| β-strand | 136-141 | 6 | 12 |
| β-strand | 144-146 | 3 | 12 |
| β-strand | 151-153 | 3 | 10 |
| β-strand | 155 | 1 | 11 |
| β-strand | 157 | 1 | 13 |
| β-strand | 160 | 1 | 13 |
| β-strand | 164-169 | 6 | 14 |
| β-strand | 176-184 | 9 | 10 |
| α-helix | 188-195 | 8 | |
| β-strand | 202-205 | 4 | 14 |
| β-strand | 210-213 | 4 | 14 |
| β-strand | 223 | 1 | 15 |
| β-strand | 226 | 1 | 15 |
| β-strand | 229-237 | 9 | 10 |
| α-helix | 238 | 1 | |
| β-strand | 242-247 | 6 | 14 |
| β-strand | 251-254 | 4 | 10 |
| β-strand | 256-262 | 7 | 10 |
| β-strand | 267-269 | 3 | 8 |
| α-helix | 272 | 1 | |
| β-strand | 273-279 | 7 | 7 |
| β-strand | 281-283 | 3 | 16 |
| β-strand | 286-288 | 3 | 16 |
| β-strand | 294-295 | 2 | 6 |
| β-strand | 301 | 1 | 17 |
| β-strand | 302-303 | 2 | 16 |
| β-strand | 305 | 1 | 18 |
| α-helix | 306 | 1 | |
| β-strand | 307-308 | 2 | 6 |
| β-strand | 315-317 | 3 | 5 |
| β-strand | 321 | 1 | 4 |
Chain B: 5 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6 | 1 | 19 |
| β-strand | 10 | 1 | 19 |
| β-strand | 14 | 1 | 2 |
| β-strand | 22-28 | 7 | 1 |
| β-strand | 31-36 | 6 | 1 |
| α-helix | 38-59 | 22 | |
| β-strand | 62 | 1 | 18 |
| β-strand | 65 | 1 | 17 |
| α-helix | 75-126 | 52 | |
| α-helix | 127-129 | 3 | |
| β-strand | 130-132 | 3 | 1 |
| β-strand | 137-140 | 4 | 1 |
| α-helix | 146-153 | 8 | |
| α-helix | 159-170 | 12 | |
Chain C: 9 helices, 44 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 12-17 | 6 | 20 |
| β-strand | 18 | 1 | 21 |
| β-strand | 25-26 | 2 | 22 |
| β-strand | 34-35 | 2 | 22 |
| β-strand | 36 | 1 | 23 |
| β-strand | 39-41 | 3 | 24 |
| β-strand | 43-44 | 2 | 25 |
| β-strand | 50-54 | 5 | 26 |
| β-strand | 56 | 1 | 26 |
| α-helix | 57-58 | 2 | |
| β-strand | 59-62 | 4 | 27 |
| β-strand | 64 | 1 | 28 |
| α-helix | 66-71 | 6 | |
| α-helix | 74-79 | 6 | |
| β-strand | 83A | 1 | 29 |
| β-strand | 87-89 | 3 | 27 |
| β-strand | 95 | 1 | 28 |
| β-strand | 102 | 1 | 29 |
| α-helix | 105-112 | 8 | |
| β-strand | 115-122 | 8 | 29 |
| α-helix | 125A-126 | 4 | |
| β-strand | 131 | 1 | 30 |
| β-strand | 136-141 | 6 | 31 |
| β-strand | 144-146 | 3 | 31 |
| β-strand | 151-153 | 3 | 29 |
| β-strand | 155 | 1 | 30 |
| β-strand | 157 | 1 | 32 |
| β-strand | 160 | 1 | 32 |
| β-strand | 164-169 | 6 | 33 |
| β-strand | 176-184 | 9 | 29 |
| α-helix | 188-195 | 8 | |
| β-strand | 202-205 | 4 | 33 |
| β-strand | 210-213 | 4 | 33 |
| α-helix | 219-222 | 4 | |
| β-strand | 223 | 1 | 34 |
| β-strand | 226 | 1 | 34 |
| β-strand | 229-237 | 9 | 29 |
| α-helix | 238 | 1 | |
| β-strand | 242-247 | 6 | 33 |
| β-strand | 251-254 | 4 | 29 |
| β-strand | 256-262 | 7 | 29 |
| β-strand | 267-269 | 3 | 27 |
| β-strand | 273-279 | 7 | 26 |
| β-strand | 281-283 | 3 | 35 |
| β-strand | 286-287 | 2 | 35 |
| β-strand | 294-295 | 2 | 25 |
| β-strand | 301 | 1 | 36 |
| β-strand | 302-303 | 2 | 35 |
| β-strand | 305 | 1 | 37 |
| α-helix | 306 | 1 | |
| β-strand | 307-308 | 2 | 25 |
| β-strand | 315-317 | 3 | 24 |
| β-strand | 321 | 1 | 23 |
Chain D: 5 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6 | 1 | 38 |
| β-strand | 10 | 1 | 38 |
| β-strand | 14 | 1 | 21 |
| β-strand | 22-28 | 7 | 20 |
| β-strand | 31-36 | 6 | 20 |
| α-helix | 38-58 | 21 | |
| β-strand | 62 | 1 | 37 |
| β-strand | 65 | 1 | 36 |
| α-helix | 75-126 | 52 | |
| α-helix | 127-129 | 3 | |
| β-strand | 130-134 | 5 | 20 |
| β-strand | 137-140 | 4 | 20 |
| α-helix | 146-153 | 8 | |
| α-helix | 160-170 | 11 | |
Chain E: 8 helices, 44 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 12-17 | 6 | 39 |
| β-strand | 18 | 1 | 40 |
| β-strand | 25-26 | 2 | 41 |
| β-strand | 34-35 | 2 | 41 |
| β-strand | 36 | 1 | 42 |
| β-strand | 39-41 | 3 | 43 |
| β-strand | 43-44 | 2 | 44 |
| β-strand | 50-54 | 5 | 45 |
| β-strand | 56 | 1 | 45 |
| α-helix | 57-58 | 2 | |
| β-strand | 59-60 | 2 | 46 |
| β-strand | 64 | 1 | 47 |
| α-helix | 66-71 | 6 | |
| α-helix | 74-79 | 6 | |
| β-strand | 83A | 1 | 48 |
| β-strand | 87-89 | 3 | 46 |
| β-strand | 95 | 1 | 47 |
| β-strand | 102 | 1 | 48 |
| α-helix | 105-112 | 8 | |
| β-strand | 115-122 | 8 | 48 |
| α-helix | 125A-126 | 4 | |
| β-strand | 131 | 1 | 49 |
| β-strand | 136-141 | 6 | 50 |
| β-strand | 144-146 | 3 | 50 |
| β-strand | 151-153 | 3 | 48 |
| β-strand | 155 | 1 | 49 |
| β-strand | 157 | 1 | 51 |
| β-strand | 160 | 1 | 51 |
| β-strand | 164-169 | 6 | 52 |
| β-strand | 176-184 | 9 | 48 |
| α-helix | 188-195 | 8 | |
| β-strand | 202-205 | 4 | 52 |
| β-strand | 210-213 | 4 | 52 |
| β-strand | 223 | 1 | 53 |
| β-strand | 226 | 1 | 53 |
| β-strand | 229-237 | 9 | 48 |
| α-helix | 238 | 1 | |
| β-strand | 242-247 | 6 | 52 |
| β-strand | 251-254 | 4 | 48 |
| β-strand | 256-262 | 7 | 48 |
| β-strand | 267-269 | 3 | 46 |
| β-strand | 273-279 | 7 | 45 |
| β-strand | 281-283 | 3 | 54 |
| β-strand | 286-288 | 3 | 54 |
| β-strand | 294-295 | 2 | 44 |
| β-strand | 301 | 1 | 55 |
| β-strand | 302-303 | 2 | 54 |
| β-strand | 305 | 1 | 56 |
| α-helix | 306 | 1 | |
| β-strand | 307-308 | 2 | 44 |
| β-strand | 315-317 | 3 | 43 |
| β-strand | 321 | 1 | 42 |
Chain F: 5 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6 | 1 | 57 |
| β-strand | 10 | 1 | 57 |
| β-strand | 14 | 1 | 40 |
| β-strand | 22-28 | 7 | 39 |
| β-strand | 31-36 | 6 | 39 |
| α-helix | 38-58 | 21 | |
| β-strand | 62 | 1 | 56 |
| β-strand | 65 | 1 | 55 |
| α-helix | 75-126 | 52 | |
| α-helix | 127-129 | 3 | |
| β-strand | 130-132 | 3 | 39 |
| β-strand | 137-140 | 4 | 39 |
| α-helix | 146-153 | 8 | |
| α-helix | 160-170 | 11 | |
Chains G, H and K: 0 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4 | 1 | 58 |
| β-strand | 18 | 1 | 58 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Hemagglutinin | A, C, E | protein | 326 | Influenza A virus (A/Puerto Rico/8/1934(H1N1)) | P03452 (AlphaFold model) |
| Hemagglutinin HA2 chain | B, D, F | protein | 176 | Influenza A virus (A/Puerto Rico/8/1934(H1N1)) | P03452 (AlphaFold model) |
| cyclic peptide CP141085 | G, H, K | protein | 19 | synthetic construct | |
Sequence of entity 1 (A, C, E), FASTA
>9PHS_1 Hemagglutinin (chains A, C, E)
DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRLKGIAPLQLGKCNIAGW
LLGNPECDPLLPVRSWSYIVETPNSENGICYPGDFIDYEELREQLSSVSSFERFEIFPKE
SSWPNHNTNGVTAACSHEGKSSFYRNLLWLTEKEGSYPKLKNSYVNKKGKEVLVLWGIHH
PPNSKEQQNLYQNENAYVSVVTSNYNRRFTPEIAERPKVRDQAGRMNYYWTLLKPGDTII
FEANGNLIAPMYAFALSRGFGSGIITSNASMHECNTKCQTPLGAINSSLPYQNIHPVTIG
ECPKYVRSAKLRMVTGLRNIPSIQSR
Sequence of entity 2 (B, D, F), FASTA
>9PHS_2 Hemagglutinin HA2 chain (chains B, D, F)
GLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNTVIEKMN
IQFTAVGKEFNKLEKRMENLNKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVKNLYE
KVKSQLKNNAKEIGNGCFEFYHKCDNECMESVRNGTYDYPKYSEESKLNREKVDGV
Sequence of entity 3 (G, H, K), FASTA
>9PHS_3 cyclic peptide CP141085 (chains G, H, K)
PPVSLYEDPLGVAGGMGVY
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CA | Calcium ion | Ca | 3 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 7 |
Water and common crystallization additives (GOL) are not listed.
Primary citation
V H H antibody loop guides design of a synthetic macrocyclic peptide that potently blocks influenza virus membrane fusion. Kadam, R.U., Juraszek, J., Brandenburg, B. et al. Npj Viruses (2025) 3:83-83. DOI 10.1038/s44298-025-00166-1 · PubMed
Other PDB entries of the same protein (UniProt P03452 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9PHD 1.59 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
- 5VLI 1.8 Å, Computationally designed inhibitor peptide HB1.6928.2.3 in complex with influenza…
- 8VQQ 2.05 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
- 1RVX 2.2 Å, 1934 H1 Hemagglutinin in complex with LSTA
- 8VQM 2.21 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
- 8VQN 2.21 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
- 1RVZ 2.25 Å, 1934 H1 Hemagglutinin in complex with LSTC
- 5W5S 2.28 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
- 8VQL 2.29 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
- 1RU7 2.3 Å, 1934 Human H1 Hemagglutinin
- 9PIB 2.35 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
- 9DXX 2.37 Å, Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in…
Browse structure collections
About this viewer
MolViewer shows 9PHS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.