Crystal structure of human caspase-1 in complex with 4-oxo-3-{6-[4-(quinoxalin-2-yloxy)-benzoylamino]-2-thiophen-2-yl-hexanoylamino}-butyric acid. Determined by X-ray diffraction at 1.85 Å resolution. Released 28 Dec 2004.
Explore 1RWX in 3D Show helices and sheets RCSB PDB PDBe
1RWX contains 10 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 134-137 | 4 | |
| α-helix | 138-147 | 10 | |
| β-strand | 152 | 1 | 1 |
| β-strand | 164-169 | 6 | 2 |
| α-helix | 182-195 | 14 | |
| β-strand | 199-204 | 6 | 2 |
| α-helix | 208-219 | 12 | |
| α-helix | 222-226 | 5 | |
| β-strand | 230-235 | 6 | 2 |
| β-strand | 238 | 1 | 3 |
| β-strand | 243-244 | 2 | 3 |
| α-helix | 245 | 1 | |
| β-strand | 255-256 | 2 | 3 |
| α-helix | 258-265 | 8 | |
| α-helix | 271-273 | 3 | |
| β-strand | 278-283 | 6 | 2 |
| β-strand | 289 | 1 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 327-331 | 5 | 2 |
| β-strand | 337 | 1 | 4 |
| β-strand | 341-342 | 2 | 5 |
| β-strand | 346-347 | 2 | 5 |
| α-helix | 348-360 | 13 | |
| α-helix | 366-376 | 11 | |
| β-strand | 388-390 | 3 | 2 |
| β-strand | 397 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-1 beta convertase | A | protein | 178 | Homo sapiens | P29466 (AlphaFold model) |
| Interleukin-1 beta convertase | B | protein | 88 | Homo sapiens | P29466 (AlphaFold model) |
>1RWX_1 Interleukin-1 beta convertase (chains A) NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRR TGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGI REGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
>1RWX_2 Interleukin-1 beta convertase (chains B) AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFS FEQPDGRAQMPTTERVTLTRCFYLFPGH
| ID | Name | Formula | Copies |
|---|---|---|---|
| YBH | 4-oxo-3-{6-[4-(quinoxalin-2-yloxy)-benzoylamino]-2-thiophen-2-yl-hexanoylamino}… | C29 H28 N4 O6 S | 1 |
Tethering identifies fragment that yields potent inhibitors of human caspase-1. Fahr, B.T., O'Brien, T., Pham, P. et al. Bioorg Med Chem Lett (2006) 16:559-562. DOI 10.1016/j.bmcl.2005.10.048 · PubMed
Other PDB entries of the same protein (UniProt P29466 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1RWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.