8WRA: CASP1 from Biortus

The Crystal Structure of CASP1 from Biortus. Determined by X-ray diffraction at 1.45 Å resolution. Released 15 Nov 2023.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,399
Mol. weight: 32.24 kDa
Released: 15 Nov 2023

Explore 8WRA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WRA contains 10 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	138-147	10
β-strand	152	1	1
β-strand	164-169	6	2
α-helix	182-195	14
β-strand	199-204	6	2
α-helix	208-219	12
α-helix	222-226	5
β-strand	230-237	8	2
β-strand	238	1	3
β-strand	242-244	3	3
α-helix	245	1
β-strand	255-257	3	3
α-helix	258-264	7
α-helix	271-273	3
β-strand	278-285	8	2
β-strand	327-332	6	2
α-helix	348-360	13
α-helix	366-376	11
α-helix	387	1
β-strand	388-390	3	2
β-strand	397	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Caspase-1	A	protein	285	Homo sapiens	P29466 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8WRA_1 Caspase-1 (chains A)
NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRR
TGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGI
REGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSV
GVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQE
YACSCDVEEIFRKVRFSFEQPDGRAQMPATERVTLTRCFYLFPGH

Primary citation

The Crystal Structure of CASP1 from Biortus. Wang, F., Cheng, W., Yuan, Z. et al. To be published.

Other PDB entries of the same protein (UniProt P29466 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BZ9 1.8 Å, Crystal structure of human caspase-1 in complex with Ac-FLTD-CMK
1SC3 1.8 Å, Crystal structure of the human caspase-1 C285A mutant in complex with malonate
2H54 1.8 Å, Crystal structure of human caspase-1 (Thr388->Ala) in complex with…
2HBQ 1.8 Å, Crystal structure of wildtype human caspase-1 in complex with…
3D6M 1.8 Å, Crystal structure of human caspase-1 with a naturally-occurring Lys319->Arg substitution…
6F6R 1.8 Å, Crystal structure of human Caspase-1 with N-{3-[1-((S)-2-Hydroxy-5-oxo-tetrahydro-furan-3…
1RWX 1.85 Å, Crystal structure of human caspase-1 in complex with 4-oxo-3-{6-[4-(quinoxalin-2-yloxy)-b…
2H4Y 1.9 Å, Crystal structure of human caspase-1 (Arg286->Lys) in complex with…
2HBZ 1.9 Å, Crystal structure of human caspase-1 (Arg286->Ala, Glu390->Ala) in complex with…
3D6F 1.9 Å, Crystal structure of human caspase-1 with a naturally-occurring Arg240->Gln substitution…
6PZP 1.94 Å, Crystal structure of caspase-1 in complex with VX-765
1RWN 2.0 Å, Crystal structure of human caspase-1 in complex with 3-{2-ethyl-6-[4-(quinoxalin-2-ylamin…

Browse structure collections

About this viewer

MolViewer shows 8WRA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.