Fab (LNKB-2) of monoclonal antibody to Human Interleukin-2, crystal structure. Determined by X-ray diffraction at 2.7 Å resolution. Released 25 May 2004.
Explore 1S5I in 3D Show helices and sheets RCSB PDB PDBe
1S5I contains 15 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 7 |
| β-strand | 11-12 | 2 | 8 |
| β-strand | 18-25 | 8 | 7 |
| β-strand | 34-39 | 7 | 9 |
| β-strand | 45-52 | 8 | 9 |
| β-strand | 57-59 | 3 | 9 |
| α-helix | 64-66 | 3 | |
| β-strand | 67-72 | 6 | 7 |
| β-strand | 77-82 | 6 | 7 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 9 |
| β-strand | 101-103 | 3 | 9 |
| β-strand | 107-109 | 3 | 9 |
| β-strand | 110-111 | 2 | 8 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 10 |
| β-strand | 120-124 | 5 | 11 |
| β-strand | 137-147 | 11 | 11 |
| β-strand | 148 | 1 | 10 |
| β-strand | 153-157 | 4 | 12 |
| α-helix | 162-164 | 3 | |
| β-strand | 166 | 1 | 12 |
| β-strand | 171-173 | 3 | 11 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-178 | 2 | 11 |
| β-strand | 185-194 | 10 | 11 |
| β-strand | 207-212 | 6 | 12 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-222 | 6 | 12 |
| α-helix | 226-228 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-14 | 5 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 27C | 1 | 3 |
| β-strand | 31 | 1 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-107 | 6 | 2 |
| β-strand | 111 | 1 | 4 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 5 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-125 | 4 | |
| β-strand | 129-139 | 11 | 5 |
| β-strand | 140 | 1 | 4 |
| β-strand | 144-150 | 7 | 6 |
| β-strand | 153-155 | 3 | 6 |
| β-strand | 159-163 | 5 | 5 |
| β-strand | 173-182 | 10 | 5 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-198 | 8 | 6 |
| β-strand | 205-210 | 6 | 6 |
| α-helix | 211-213 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fab-fragment of monoclonal antibody | L | protein | 219 | Mus musculus | |
| Fab-fragment of monoclonal antibody | H | protein | 220 | Mus musculus | P01869 (AlphaFold model) |
>1S5I_1 Fab-fragment of monoclonal antibody (chains L) DVQMTQTPLTLSVTIGQPASISCESSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLD SGVPDRFTGSGSGTDFTLRISRVEAEDLGVYYCVQGTHFPRTFGGGTKLEIKRADAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1S5I_2 Fab-fragment of monoclonal antibody (chains H) GVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYITYSGSTGY NPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCASYDDYTWFTYWGQGTLVTVSAAK TTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLY TLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
[A new crystal form of the Fab fragment of a monoclonal antibody to human interleukin-2: the three-dimensional structure at 2.7 A resolution]. Pletnev, V.Z., Goriacheva, E.A., Tsygannik, I.N. et al. Bioorg Khim 30:466-469. PubMed
Other PDB entries of the same protein (UniProt P01869 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1S5I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.