1SHG: Src-homology 3 (SH3) domain

Crystal structure of a src-homology 3 (SH3) domain. Determined by X-ray diffraction at 1.8 Å resolution. Released 31 Oct 1993.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Gallus gallus
Chains: 1
Atoms: 472
Mol. weight: 7.23 kDa
Released: 31 Oct 1993

Explore 1SHG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SHG contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
β-strand	15	1	2
β-strand	22	1	1
β-strand	25	1	2
β-strand	30-35	6	1
β-strand	41-46	6	1
β-strand	49-54	6	1
α-helix	55-57	3
β-strand	58-61	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-spectrin SH3 domain	A	protein	62	Gallus gallus	P07751 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SHG_1 ALPHA-SPECTRIN SH3 DOMAIN (chains A)
MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKK
LD

Primary citation

Crystal structure of a Src-homology 3 (SH3) domain. Musacchio, A., Noble, M., Pauptit, R. et al. Nature (1992) 359:851-855. DOI 10.1038/359851a0 · PubMed

Other PDB entries of the same protein (UniProt P07751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IHA 1.01 Å, A-spectrin SH3 domain V9L, A11V, M25V, V46F, V58L mutant
9EYC 1.06 Å, A-spectrin SH3 domain V9L, A11V, V23L, M25C, V46W, V53L and V58L mutant
3NGP 1.08 Å, High resolution structure of alpha-spectrin SH3 domain mutant with a redesigned core
3M0R 1.1 Å, Crystal Structure of the R21D mutant of alpha-spectrin SH3 domain. Crystal obtained in…
3M0U 1.1 Å, Crystal Structure of the R21D mutant of alpha-spectrin SH3 domain. Hexagonal crystal…
1G2B 1.12 Å, Alpha-spectrin src homology 3 domain, circular permutant, cut at N47-D48
9IH7 1.12 Å, A-spectrin SH3 domain V9L, A11V, V23I, M25V, V46F, V53L, V58L mutant
9EYE 1.13 Å, A-spectrin SH3 domain V9L, A11V, L31V, V44I, V53I mutant
9IH6 1.31 Å, A-spectrin SH3 domain V9Y, A11V, V23L, M25V, V53L, V58L mutant
9EYB 1.34 Å, A-spectrin SH3 domain V9L, A11V, V23L, M25C, V46W, V53L and V58L mutant
9EYF 1.34 Å, A-spectrin SH3 domain V9L, A11V, V23L, M25L, V46Y, V53I mutant
5IHK 1.35 Å, Crystal Structure of the alpha spectrin SH3 domain mutant N47A

Browse more

1SHG is part of these collections:

Classic small proteins for teaching

About this viewer

MolViewer shows 1SHG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.