1SLN: Stromelysin-1

Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with the N-carboxy-alkyl inhibitor L-702,842. Determined by X-ray diffraction at 2.27 Å resolution. Released 17 Dec 1996.

Method: X-ray diffraction
Resolution: 2.27 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,429
Mol. weight: 20.15 kDa
Ligands: 8MI, CA, ZN
Released: 17 Dec 1996

Explore 1SLN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SLN contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	85	1	1
β-strand	96-101	6	2
α-helix	110-125	16
β-strand	131-134	4	2
β-strand	142-147	6	2
β-strand	165-167	3	2
β-strand	178-181	4	2
β-strand	186-187	2	3
β-strand	193-194	2	3
α-helix	195-206	12
β-strand	209	1	1
α-helix	236-246	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stromelysin-1	A	protein	173	Homo sapiens	P08254 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SLN_1 STROMELYSIN-1 (chains A)
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADI
MISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHE
IGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPET

Ligands and cofactors

ID	Name	Formula	Copies
8MI	N-(R-carboxy-ethyl)-alpha-(S)-(2-phenylethyl)glycyl-L-arginine-N-phenylamide	C25 H35 N6 O4	1
CA	Calcium ion	Ca	3
ZN	Zinc ion	Zn	2

Primary citation

Stromelysin-1: three-dimensional structure of the inhibited catalytic domain and of the C-truncated proenzyme. Becker, J.W., Marcy, A.I., Rokosz, L.L. et al. Protein Sci (1995) 4:1966-1976. PubMed

Other PDB entries of the same protein (UniProt P08254 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HY7 1.5 Å, A carboxylic acid based inhibitor in complex with MMP3
1CIZ 1.64 Å, X-ray structure of human stromelysin catalytic domain complexes with non-peptide…
1HFS 1.7 Å, Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited…
1CAQ 1.8 Å, X-ray structure of human stromelysin catalytic domain complexes with non-peptide…
1USN 1.8 Å, Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited…
1C3I 1.83 Å, Human stromelysin-1 catalytic domain complexed with ro-26-2812
4G9L 1.88 Å, Structure of MMP3 complexed with NNGH inhibitor.
1G49 1.9 Å, A carboxylic acid based inhibitor in complex with MMP3
1SLM 1.9 Å, Crystal structure of fibroblast stromelysin-1: the C-truncated human proenzyme
4DPE 1.96 Å, Structure of MMP3 complexed with a platinum-based inhibitor.
4JA1 1.96 Å, Structure of MMP3 complexed with a platinum-based inhibitor
1B8Y 2.0 Å, X-ray structure of human stromelysin catalytic domain complexed with non-peptide…

Browse structure collections

About this viewer

MolViewer shows 1SLN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.