1SVC: Nfkb P50 homodimer

Nfkb P50 homodimer bound to DNA. Determined by X-ray diffraction at 2.6 Å resolution. Released 10 Jun 1996.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,903
Mol. weight: 47.01 kDa
Released: 10 Jun 1996

Explore 1SVC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SVC contains 15 α-helices and 27 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain P: 15 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	44-49	6	1
α-helix	50	1
β-strand	51	1	2
α-helix	52	1
β-strand	54	1	3
β-strand	59-60	2	4
α-helix	61-63	3
β-strand	72	1	2
β-strand	84-88	5	1
β-strand	95-101	7	3
β-strand	109	1	3
β-strand	113-116	4	4
β-strand	119-120	2	3
β-strand	123-127	5	3
β-strand	134-136	3	1
β-strand	140-144	5	4
α-helix	147-149	3
α-helix	150-164	15
α-helix	168-171	4
α-helix	174-179	6
α-helix	191-205	15
β-strand	212-222	11	3
β-strand	228-231	4	3
β-strand	235-241	7	3
α-helix	246-248	3
α-helix	249-251	3
β-strand	253-256	4	5
β-strand	260-262	3	6
β-strand	268-273	6	5
α-helix	278-280	3
β-strand	282-289	8	6
β-strand	293-298	6	6
α-helix	299	1
β-strand	300	1	5
α-helix	303-305	3
β-strand	306-307	2	5
β-strand	311-315	5	5
α-helix	316-318	3
β-strand	328-335	8	6
β-strand	342	1	6
α-helix	343-345	3
β-strand	346-351	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(apgpaptpgpgpgpgpapaptpcpcpcpcptpa pgp*a)-3')	D	DNA	19
Protein (nuclear factor kappa-B (nf-kb))	P	protein	365	Homo sapiens	P19838 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>1SVC_1 DNA (5'-D(*AP*GP*AP*TP*GP*GP*GP*GP*AP*AP*TP*CP*CP*CP*CP*TP*A P*GP*A)-3') (chains D)
AGATGGGGAATCCCCTAGA

Sequence of entity 2 (P), FASTA

>1SVC_2 PROTEIN (NUCLEAR FACTOR KAPPA-B (NF-KB)) (chains P)
AEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYV
AEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQK

Primary citation

Structure of the NF-kappa B p50 homodimer bound to DNA. Muller, C.W., Rey, F.A., Sodeoka, M. et al. Nature (1995) 373:311-317. DOI 10.1038/373311a0 · PubMed

Other PDB entries of the same protein (UniProt P19838 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8TQD 2.02 Å, NF-Kappa-B1 Bound with a Covalent Inhibitor
7LFC 2.1 Å, Structure of importin a3 bound to p50 NLS
7RG5 2.15 Å, Importin alpha3 in complex with p50 NLS
7LEQ 2.24 Å, Structure of importin a2 bound to p50 NLS
7LET 2.4 Å, Structure of importin a2 bound to the p50- and p65-NLSs
7RG4 2.6 Å, Importin alpha2 in complex with p50 NLS
1NFI 2.7 Å, I-kappa-B-alpha/nf-kappa-B complex
2O61 2.8 Å, Crystal Structure of NFkB, IRF7, IRF3 bound to the interferon-b enhancer
7LF4 2.85 Å, Structure of importin a3 bound to the p50- and p65-NLSs
3GUT 3.59 Å, Crystal structure of a higher-order complex of p50:RelA bound to the HIV-1 LTR
1MDI High resolution solution NMR structure of mixed disulfide intermediate between mutant…
1MDJ High resolution solution NMR structure of mixed disulfide intermediate between human…

Browse structure collections

About this viewer

MolViewer shows 1SVC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.