1SXE: Transcriptional regulator ERG

The solution structure of the Pointed (PNT) domain from the transcrition factor Erg. Determined by solution NMR. Released 21 Sept 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 801
Mol. weight: 11.4 kDa
Released: 21 Sept 2004

Explore 1SXE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SXE contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	109-112	4
α-helix	114-116	3
α-helix	136-150	15
α-helix	157-159	3
α-helix	165-168	4
α-helix	173-176	4
α-helix	182-195	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcriptional regulator ERG	A	protein	97	Homo sapiens	P11308 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SXE_1 Transcriptional regulator ERG (chains A)
GSHMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNID
GKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLP

Primary citation

Diversity in Structure and Function of the Ets Family PNT Domains. Mackereth, C.D., Schaerpf, M., Gentile, L.N. et al. J Mol Biol (2004) 342:1249-1264. DOI 10.1016/j.jmb.2004.07.094 · PubMed

Other PDB entries of the same protein (UniProt P11308 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IRG 1.7 Å, Uninhibited DNA-binding domain of the Ets transcription factor ERG
4IRH 2.1 Å, Auto-inhibited ERG Ets domain
5YBC 2.5 Å, X-ray structure of native ETS-domain domain of Ergp55
5YBD 2.77 Å, X-ray structure of ETS domain of Ergp55 in complex with E74DNA
4IRI 2.77 Å, Auto-inhibited ERG Ets Domain-DNA Complex
6VGE 4.25 Å, Crystal structure of the DNA binding domains of human transcription factor ERG, human…
6VGG 4.31 Å, Crystal structure of the DNA binding domains of human transcription factor ERG, human…

Browse structure collections

About this viewer

MolViewer shows 1SXE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.