1T5C: Motor domain of human kinetochore protein CENP-E

Crystal structure of the motor domain of human kinetochore protein CENP-E. Determined by X-ray diffraction at 2.5 Å resolution. Released 10 May 2005.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,217
Mol. weight: 79.94 kDa
Ligands: PIN, ADP, MG
Released: 10 May 2005

Explore 1T5C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T5C contains 26 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	1
α-helix	14-16	3
β-strand	31-34	4	2
β-strand	37-40	4	2
β-strand	46-48	3	2
β-strand	52-53	2	1
α-helix	59-62	4
α-helix	63-67	5
α-helix	68-75	8
β-strand	80-86	7	1
α-helix	92-96	5
β-strand	98	1	3
β-strand	103	1	3
α-helix	105-116	12
α-helix	117-119	3
β-strand	123-135	13	1
β-strand	138-141	4	1
β-strand	152-156	5	4
β-strand	161-164	4	4
β-strand	170-171	2	1
α-helix	175-187	13
β-strand	204-215	12	1
β-strand	226-235	10	1
α-helix	236-238	3
α-helix	239-241	3
α-helix	260-274	15
α-helix	283-285	3
α-helix	287-291	5
α-helix	293-295	3
β-strand	301-308	8	1
α-helix	314-326	13
β-strand	337-338	2	1

Chain B: 11 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	5
β-strand	31-34	4	6
β-strand	37-40	4	6
β-strand	46-48	3	6
β-strand	52-53	2	5
α-helix	59-62	4
α-helix	63-67	5
α-helix	68-74	7
β-strand	80-86	7	5
α-helix	92-96	5
β-strand	98	1	7
β-strand	103	1	7
α-helix	105-117	13
β-strand	123-124	2	8
β-strand	127-135	9	5
β-strand	138-141	4	5
β-strand	170-172	3	5
α-helix	175-187	13
α-helix	200-202	3
β-strand	204-213	10	5
β-strand	214-215	2	8
β-strand	226-235	10	5
α-helix	260-274	15
α-helix	283-285	3
α-helix	287-291	5
β-strand	302-308	7	5
α-helix	314-326	13
β-strand	337-338	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Centromeric protein E	A, B	protein	349	Homo sapiens	Q02224 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1T5C_1 Centromeric protein E (chains A, B)
AEEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFHGNETTKN
VYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFP
DREFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKW
ITKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSER
AAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNAK
TRIICTITPVSFDETLTALQFASTAKYMKNTPYVNEVSTDELEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
PIN	Piperazine-n,n'-BIS(2-ethanesulfonic acid)	C8 H18 N2 O6 S2	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
MG	Magnesium ion	Mg	2

Water and common crystallization additives (NO3) are not listed.

Primary citation

Crystal structure of the motor domain of the human kinetochore protein CENP-E. Garcia-Saez, I., Yen, T., Wade, R.H. et al. J Mol Biol (2004) 340:1107-1116. DOI 10.1016/j.jmb.2004.05.053 · PubMed

Other PDB entries of the same protein (UniProt Q02224 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HFH 1.8 Å, CENP-E motor domain in complex with AMPPNP and Mg2+
6M4I 1.9 Å, Structure of CENP-E motor domain at 1.9 angstrom resolution
5JVP 2.1 Å, The neck-linker and alpha 7 helix of Homo sapiens CENP-E
8OWI 2.14 Å, Crystal structure of the corona-targeting domain of CENP-E
8WHL 3.2 Å, Crystal structure of CLASP2 in complex with CENP-E

Browse structure collections

About this viewer

MolViewer shows 1T5C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.