6M4I: CENP-E motor domain

Structure of CENP-E motor domain at 1.9 angstrom resolution. Determined by X-ray diffraction at 1.9 Å resolution. Released 10 Mar 2021.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,120
Mol. weight: 80.5 kDa
Ligands: MG, ADP
Released: 10 Mar 2021

Explore 6M4I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6M4I contains 33 α-helices and 35 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	1
α-helix	14-16	3
β-strand	31-34	4	2
β-strand	37-40	4	2
β-strand	46-48	3	2
β-strand	51-53	3	1
α-helix	59-62	4
α-helix	63-67	5
α-helix	68-75	8
β-strand	80-85	6	1
α-helix	92-96	5
β-strand	98-99	2	3
β-strand	102-103	2	3
α-helix	105-116	12
α-helix	117-119	3
β-strand	123-135	13	1
β-strand	138-141	4	1
β-strand	152	1	1
β-strand	154-156	3	4
β-strand	162-164	3	4
β-strand	170-172	3	1
α-helix	175-190	16
α-helix	199-201	3
β-strand	204-215	12	1
β-strand	226-235	10	1
α-helix	236-238	3
α-helix	239-241	3
α-helix	260-273	14
α-helix	278-280	3
α-helix	283-285	3
α-helix	287-291	5
α-helix	293-295	3
β-strand	301-308	8	1
α-helix	314-326	13
β-strand	337-338	2	1

Chain B: 16 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	5
α-helix	14-16	3
β-strand	31-34	4	6
β-strand	37-40	4	6
β-strand	46-48	3	6
β-strand	51-53	3	5
α-helix	59-62	4
α-helix	63-67	5
α-helix	68-75	8
β-strand	80-86	7	5
α-helix	92-96	5
β-strand	98-99	2	7
β-strand	102-103	2	7
α-helix	105-116	12
α-helix	117-119	3
β-strand	123-135	13	5
β-strand	138-141	4	5
β-strand	154-156	3	8
β-strand	162-164	3	8
β-strand	170-172	3	5
α-helix	175-190	16
α-helix	199-201	3
β-strand	204-215	12	5
β-strand	226-235	10	5
α-helix	236-238	3
α-helix	239-241	3
α-helix	260-273	14
α-helix	283-285	3
α-helix	287-291	5
α-helix	293-295	3
β-strand	301-308	8	5
α-helix	314-326	13
β-strand	337-338	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Centromere-associated protein E	A, B	protein	353	Homo sapiens	Q02224 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6M4I_1 Centromere-associated protein E (chains A, B)
MNHKVHMAEEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFH
GNETTKNVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIF
QKIKKFPDREFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYT
SEMALKWITKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLV
DLAGSERAAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGFINYRDSKLTRILQN
SLGGNPKTRIICTITPVSFDETLTALQFASTAKYMKNTPYVNEVSGSHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Structure and comparison of the motor domain ofcentromere-associated protein E. Shibuya, A., Ogo, N., Sawada, J. et al. Acta Crystallogr D Biol Crystallogr (2021) 77:280-287. DOI 10.1107/S2059798321000176

Other PDB entries of the same protein (UniProt Q02224 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HFH 1.8 Å, CENP-E motor domain in complex with AMPPNP and Mg2+
5JVP 2.1 Å, The neck-linker and alpha 7 helix of Homo sapiens CENP-E
8OWI 2.14 Å, Crystal structure of the corona-targeting domain of CENP-E
1T5C 2.5 Å, Crystal structure of the motor domain of human kinetochore protein CENP-E
8WHL 3.2 Å, Crystal structure of CLASP2 in complex with CENP-E

Browse structure collections

About this viewer

MolViewer shows 6M4I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.