5JVP: PDB entry 5JVP
The neck-linker and alpha 7 helix of Homo sapiens CENP-E. Determined by X-ray diffraction at 2.1 Å resolution. Released 3 Aug 2016.
- Method
- X-ray diffraction
- Resolution
- 2.1 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 4,823
- Mol. weight
- 64.63 kDa
- Ligands
- CD
- Released
- 3 Aug 2016
Explore 5JVP in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5JVP contains 13 α-helices and 10 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-63 | 56 | |
| α-helix | 72-79 | 8 | |
Chains B and E: 2 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-63 | 56 | |
| α-helix | 70-79 | 10 | |
| β-strand | 83 | 1 | 1 |
| β-strand | 86 | 1 | 1 |
Chain C: 3 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-62 | 55 | |
| α-helix | 69-73 | 5 | |
| α-helix | 74-79 | 6 | |
| β-strand | 83 | 1 | 2 |
| β-strand | 86 | 1 | 2 |
Chain D: 2 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-64 | 57 | |
| α-helix | 70-80 | 11 | |
| β-strand | 83 | 1 | 3 |
| β-strand | 86 | 1 | 3 |
Chain F: 2 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-62 | 55 | |
| α-helix | 70-79 | 10 | |
| β-strand | 83 | 1 | 5 |
| β-strand | 86 | 1 | 5 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family… | A, B, C, D, E, F | protein | 90 | Homo sapiens | Q02224 (AlphaFold model), Q15691 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>5JVP_1 Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1 (chains A, B, C, D, E, F)
LSNEVSTDEALLKRYRKEIMDLKKQLEEVSLETRAQAMEKDQLEKERDFYFGKLRNIELI
CQENEGENDPVLQRIVDILYATDEGFVIPD
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CD | Cadmium ion | Cd | 3 |
Primary citation
Family-specific Kinesin Structures Reveal Neck-linker Length Based on Initiation of the Coiled-coil. Phillips, R.K., Peter, L.G., Gilbert, S.P. et al. J Biol Chem (2016) 291:20372-20386. DOI 10.1074/jbc.M116.737577 · PubMed
Other PDB entries of the same protein (UniProt Q02224 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8HFH 1.8 Å, CENP-E motor domain in complex with AMPPNP and Mg2+
- 6M4I 1.9 Å, Structure of CENP-E motor domain at 1.9 angstrom resolution
- 8OWI 2.14 Å, Crystal structure of the corona-targeting domain of CENP-E
- 1T5C 2.5 Å, Crystal structure of the motor domain of human kinetochore protein CENP-E
- 8WHL 3.2 Å, Crystal structure of CLASP2 in complex with CENP-E
Browse structure collections
About this viewer
MolViewer shows 5JVP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.