8HFH: CENP-E motor domain

CENP-E motor domain in complex with AMPPNP and Mg2+. Determined by X-ray diffraction at 1.8 Å resolution. Released 8 Mar 2023.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,909
Mol. weight: 40.47 kDa
Ligands: MG, ANP
Released: 8 Mar 2023

Explore 8HFH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HFH contains 15 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	1
α-helix	14-16	3
α-helix	18-21	4
β-strand	31-33	3	2
β-strand	37-40	4	2
β-strand	46-48	3	2
β-strand	51-53	3	1
α-helix	59-62	4
α-helix	63-67	5
α-helix	68-75	8
β-strand	80-85	6	1
α-helix	92-96	5
β-strand	98-99	2	3
β-strand	102-103	2	3
α-helix	105-117	13
β-strand	123-135	13	1
β-strand	138-141	4	1
α-helix	146-148	3
β-strand	152	1	1
β-strand	154-156	3	4
β-strand	162-164	3	4
β-strand	170-172	3	1
α-helix	175-188	14
β-strand	191-192	2	5
β-strand	200-201	2	5
β-strand	204-215	12	1
β-strand	226-235	10	1
α-helix	242-245	4
α-helix	249-274	26
α-helix	283-285	3
α-helix	287-291	5
α-helix	293-295	3
β-strand	301-308	8	1
α-helix	314-326	13
β-strand	337-338	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Centromere-associated protein E	A	protein	353	Homo sapiens	Q02224 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8HFH_1 Centromere-associated protein E (chains A)
MNHKVHMAEEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFH
GNETTKNVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIF
QKIKKFPDREFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYT
SEMALKWITKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLV
DLAGSERAAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGFINYRDSKLTRILQN
SLGGNPKTRIICTITPVSFDETLTALQFASTAKYMKNTPYVNEVSGSHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Water and common crystallization additives (IMD, NA) are not listed.

Primary citation

Crystal structure of the motor domain of centromere-associated protein E in complex with a non-hydrolysable ATP analogue. Shibuya, A., Suzuki, A., Ogo, N. et al. FEBS Lett (2023) 597:1138-1148. DOI 10.1002/1873-3468.14602 · PubMed

Other PDB entries of the same protein (UniProt Q02224 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6M4I 1.9 Å, Structure of CENP-E motor domain at 1.9 angstrom resolution
5JVP 2.1 Å, The neck-linker and alpha 7 helix of Homo sapiens CENP-E
8OWI 2.14 Å, Crystal structure of the corona-targeting domain of CENP-E
1T5C 2.5 Å, Crystal structure of the motor domain of human kinetochore protein CENP-E
8WHL 3.2 Å, Crystal structure of CLASP2 in complex with CENP-E

Browse structure collections

About this viewer

MolViewer shows 8HFH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.