1TBP: Tata-binding protein

Name: PDB 1TBP: Crystal structure of yeast tata-binding protein and model for interaction with DNA
Published: 1994-01-31
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: binding protein

Crystal structure of yeast tata-binding protein and model for interaction with DNA. Determined by X-ray diffraction at 2.6 Å resolution. Released 31 Jan 1994.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,834
Mol. weight: 40.33 kDa
Released: 31 Jan 1994

Explore 1TBP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TBP contains 8 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	66-75	10	1
α-helix	82-89	8
β-strand	93	1	1
β-strand	102-106	5	1
β-strand	111-115	5	1
β-strand	120-126	7	1
α-helix	129-142	14
β-strand	156-165	10	1
β-strand	170	1	2
α-helix	172-178	7
β-strand	183-184	2	1
β-strand	193-197	5	1
β-strand	202-206	5	1
β-strand	211-217	7	1
α-helix	221-236	16
β-strand	238	1	2

Chain B: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	66-75	10	3
α-helix	82-86	5
β-strand	95	1	4
β-strand	99	1	4
β-strand	102-105	4	3
β-strand	112-115	4	3
β-strand	120-126	7	3
α-helix	129-146	18
β-strand	153-165	13	3
β-strand	170	1	5
α-helix	172-178	7
β-strand	183-184	2	3
β-strand	193-198	6	3
β-strand	201-206	6	3
β-strand	211-215	5	3
α-helix	220-234	15
β-strand	238	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tata-binding protein	A, B	protein	180	Saccharomyces cerevisiae	P13393 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1TBP_1 TATA-BINDING PROTEIN (chains A, B)
MGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGK
MVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHG
TFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM

Primary citation

Crystal structure of yeast TATA-binding protein and model for interaction with DNA. Chasman, D.I., Flaherty, K.M., Sharp, P.A. et al. Proc Natl Acad Sci U S A (1993) 90:8174-8178. DOI 10.1073/pnas.90.17.8174 · PubMed

Other PDB entries of the same protein (UniProt P13393 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YTB 1.8 Å, Crystal structure of a yeast tbp/tata-box complex
1NH2 1.9 Å, Crystal structure of a yeast TFIIA/TBP/DNA complex
4B0A 1.97 Å, The high-resolution structure of yTBP-yTAF1 identifies conserved and competing…
6E16 2.4 Å, Ternary structure of c-Myc-TBP-TAF1
1RM1 2.5 Å, Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
1YTF 2.5 Å, Yeast tfiia/tbp/dna complex
7Z0O 2.8 Å, Structure of transcription factor UAF in complex with TBP and 35S rRNA promoter DNA
7O4J 2.9 Å, Yeast RNA polymerase II transcription pre-initiation complex (consensus)
7OHA 2.9 Å, nucleosome with TBP and TFIIA bound at SHL +2
1NGM 2.95 Å, Crystal structure of a yeast Brf1-TBP-DNA ternary complex
7ML0 3.0 Å, RNA polymerase II pre-initiation complex (PIC1)
7OH9 3.0 Å, Nucleosome with TBP and TFIIA bound at SHL -6

Browse structure collections

About this viewer

MolViewer shows 1TBP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.