1TBR: Thrombin

Crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin. Determined by X-ray diffraction at 2.6 Å resolution. Released 14 Oct 1996.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Bos taurus, Rhodnius prolixus
Chains: 6
Atoms: 6,733
Mol. weight: 93.2 kDa
Released: 14 Oct 1996

Explore 1TBR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TBR contains 41 α-helices and 61 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-35	6	3
β-strand	39-46	8	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	60-60A	2	4
α-helix	60B-60D	3
β-strand	60F-60G	2	4
β-strand	64-68	5	3
β-strand	72	1	5
β-strand	81-90	10	3
β-strand	95	1	6
β-strand	100	1	6
β-strand	104-108	5	3
α-helix	111-114	4
α-helix	120-121	2
β-strand	122	1	2
α-helix	123-124	2
α-helix	126-129C	7
β-strand	135-140	6	2
β-strand	154	1	5
β-strand	156-162	7	2
α-helix	163-164	2
α-helix	165-171	7
β-strand	180-183	4	2
α-helix	184-185	2
β-strand	189	1	1
β-strand	198-202	5	2
β-strand	207-217	11	2
β-strand	226-230	5	2
α-helix	235-243	9

Chain J: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	1J-1G	4
α-helix	1C-1A	3
α-helix	8-10	3
α-helix	14D-14L	9

Chain K: 12 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	7
β-strand	20-21	2	8
α-helix	22-23	2
β-strand	30-35	6	9
β-strand	40-46	7	9
β-strand	51-54	4	9
α-helix	56-58	3
β-strand	60-60A	2	10
α-helix	60B-60D	3
β-strand	60F-60G	2	10
α-helix	61-63	3
β-strand	64-68	5	9
β-strand	72	1	11
β-strand	81-83	3	9
β-strand	85-90	6	9
β-strand	95	1	12
β-strand	100	1	12
β-strand	104-108	5	9
α-helix	111-114	4
β-strand	115	1	13
β-strand	118	1	13
α-helix	120-121	2
β-strand	122	1	8
α-helix	123-124	2
α-helix	126-129C	7
β-strand	135-140	6	8
β-strand	154	1	11
β-strand	156-162	7	8
α-helix	165-171	7
β-strand	180-183	4	8
α-helix	184-185	2
β-strand	189	1	7
β-strand	198-202	5	8
β-strand	207-217	11	8
β-strand	226-230	5	8
α-helix	232-234	3
α-helix	235-243	9

Chain L: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	1J-1G	4
α-helix	1C-1A	3
α-helix	8-10	3
α-helix	14C-14L	10

Chain R: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	7-9	3	2
β-strand	15-17	3	14
β-strand	22-23	2	14
α-helix	26-33	8
β-strand	42-45	4	14
α-helix	50-52	3
α-helix	58-60	3
α-helix	63-65	3
β-strand	68-70	3	15
β-strand	74-76	3	15
α-helix	79-85	7
β-strand	95-98	4	15

Chain S: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	7-9	3	8
β-strand	15-17	3	16
β-strand	21-23	3	16
α-helix	26-34	9
β-strand	42-45	4	16
α-helix	58-60	3
β-strand	68-70	3	17
β-strand	74-76	3	17
α-helix	79-86	8
β-strand	95-98	4	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thrombin	J, L	protein	49	Bos taurus	P00735 (AlphaFold model)
Thrombin	H, K	protein	259	Bos taurus	P00735 (AlphaFold model)
Rhodniin	R, S	protein	103	Rhodnius prolixus	Q06684 (AlphaFold model)

Sequence of entity 1 (J, L), FASTA

>1TBR_1 THROMBIN (chains J, L)
TSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR

Sequence of entity 2 (H, K), FASTA

>1TBR_2 THROMBIN (chains H, K)
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLL
VRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCL
PDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIR
ITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFY
THVFRLKKWIQKVIDRLGS

Sequence of entity 3 (R, S), FASTA

>1TBR_3 RHODNIIN (chains R, S)
EGGEPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQEC
DGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT

Primary citation

Two heads are better than one: crystal structure of the insect derived double domain Kazal inhibitor rhodniin in complex with thrombin. van de Locht, A., Lamba, D., Bauer, M. et al. EMBO J (1995) 14:5149-5157. PubMed

Other PDB entries of the same protein (UniProt P00735 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7A0D 1.6 Å, The Crystal Structure of Bovine Thrombin in complex with Hirudin (C16U/C28U) at 1.6…
1NL1 1.9 Å, Bovine prothrombin fragment 1 in complex with calcium ion
7A0E 1.9 Å, The Crystal Structure of Bovine Thrombin in complex with Hirudin (C6U/C14U) at 1.9…
1ETR 2.2 Å, Refined 2.3 Å X-ray crystal structure of bovine thrombin complexes formed with the…
1MKX 2.2 Å, The co-crystal structure of unliganded bovine alpha-thrombin and prethrombin-2: movement…
1UCY 2.2 Å, Thrombin complexed with fibrinopeptide a alpha (residues 7-19). Three complexes, one…
2PF2 2.2 Å, The CA+2 ion and membrane binding structure of the gla domain of ca-prothrombin fragment 1
3PMA 2.2 Å, 2.2 Angstrom crystal structure of the complex between Bovine Thrombin and Sucrose…
1BBR 2.3 Å, The structure of residues 7-16 of the a alpha chain of human fibrinogen bound to bovine…
1ETS 2.3 Å, Refined 2.3 Å X-ray crystal structure of bovine thrombin complexes formed with the…
1MKW 2.3 Å, The co-crystal structure of unliganded bovine alpha-thrombin and prethrombin-2: movement…
1NL2 2.3 Å, Bovine prothrombin fragment 1 in complex with calcium and lysophosphotidylserine

Browse structure collections

About this viewer

MolViewer shows 1TBR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.