1TBR: Thrombin
Crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin. Determined by X-ray diffraction at 2.6 Å resolution. Released 14 Oct 1996.
- Method
- X-ray diffraction
- Resolution
- 2.6 Å
- Organisms
- Bos taurus, Rhodnius prolixus
- Chains
- 6
- Atoms
- 6,733
- Mol. weight
- 93.2 kDa
- Released
- 14 Oct 1996
Explore 1TBR in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1TBR contains 41 α-helices and 61 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain H: 11 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-35 | 6 | 3 |
| β-strand | 39-46 | 8 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-58 | 3 | |
| β-strand | 60-60A | 2 | 4 |
| α-helix | 60B-60D | 3 | |
| β-strand | 60F-60G | 2 | 4 |
| β-strand | 64-68 | 5 | 3 |
| β-strand | 72 | 1 | 5 |
| β-strand | 81-90 | 10 | 3 |
| β-strand | 95 | 1 | 6 |
| β-strand | 100 | 1 | 6 |
| β-strand | 104-108 | 5 | 3 |
| α-helix | 111-114 | 4 | |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 2 |
| α-helix | 123-124 | 2 | |
| α-helix | 126-129C | 7 | |
| β-strand | 135-140 | 6 | 2 |
| β-strand | 154 | 1 | 5 |
| β-strand | 156-162 | 7 | 2 |
| α-helix | 163-164 | 2 | |
| α-helix | 165-171 | 7 | |
| β-strand | 180-183 | 4 | 2 |
| α-helix | 184-185 | 2 | |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-202 | 5 | 2 |
| β-strand | 207-217 | 11 | 2 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 235-243 | 9 | |
Chain J: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1J-1G | 4 | |
| α-helix | 1C-1A | 3 | |
| α-helix | 8-10 | 3 | |
| α-helix | 14D-14L | 9 | |
Chain K: 12 helices, 25 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 17 | 1 | 7 |
| β-strand | 20-21 | 2 | 8 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-35 | 6 | 9 |
| β-strand | 40-46 | 7 | 9 |
| β-strand | 51-54 | 4 | 9 |
| α-helix | 56-58 | 3 | |
| β-strand | 60-60A | 2 | 10 |
| α-helix | 60B-60D | 3 | |
| β-strand | 60F-60G | 2 | 10 |
| α-helix | 61-63 | 3 | |
| β-strand | 64-68 | 5 | 9 |
| β-strand | 72 | 1 | 11 |
| β-strand | 81-83 | 3 | 9 |
| β-strand | 85-90 | 6 | 9 |
| β-strand | 95 | 1 | 12 |
| β-strand | 100 | 1 | 12 |
| β-strand | 104-108 | 5 | 9 |
| α-helix | 111-114 | 4 | |
| β-strand | 115 | 1 | 13 |
| β-strand | 118 | 1 | 13 |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 8 |
| α-helix | 123-124 | 2 | |
| α-helix | 126-129C | 7 | |
| β-strand | 135-140 | 6 | 8 |
| β-strand | 154 | 1 | 11 |
| β-strand | 156-162 | 7 | 8 |
| α-helix | 165-171 | 7 | |
| β-strand | 180-183 | 4 | 8 |
| α-helix | 184-185 | 2 | |
| β-strand | 189 | 1 | 7 |
| β-strand | 198-202 | 5 | 8 |
| β-strand | 207-217 | 11 | 8 |
| β-strand | 226-230 | 5 | 8 |
| α-helix | 232-234 | 3 | |
| α-helix | 235-243 | 9 | |
Chain L: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1J-1G | 4 | |
| α-helix | 1C-1A | 3 | |
| α-helix | 8-10 | 3 | |
| α-helix | 14C-14L | 10 | |
Chain R: 6 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-6 | 3 | |
| β-strand | 7-9 | 3 | 2 |
| β-strand | 15-17 | 3 | 14 |
| β-strand | 22-23 | 2 | 14 |
| α-helix | 26-33 | 8 | |
| β-strand | 42-45 | 4 | 14 |
| α-helix | 50-52 | 3 | |
| α-helix | 58-60 | 3 | |
| α-helix | 63-65 | 3 | |
| β-strand | 68-70 | 3 | 15 |
| β-strand | 74-76 | 3 | 15 |
| α-helix | 79-85 | 7 | |
| β-strand | 95-98 | 4 | 15 |
Chain S: 4 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-6 | 3 | |
| β-strand | 7-9 | 3 | 8 |
| β-strand | 15-17 | 3 | 16 |
| β-strand | 21-23 | 3 | 16 |
| α-helix | 26-34 | 9 | |
| β-strand | 42-45 | 4 | 16 |
| α-helix | 58-60 | 3 | |
| β-strand | 68-70 | 3 | 17 |
| β-strand | 74-76 | 3 | 17 |
| α-helix | 79-86 | 8 | |
| β-strand | 95-98 | 4 | 17 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Thrombin | J, L | protein | 49 | Bos taurus | P00735 (AlphaFold model) |
| Thrombin | H, K | protein | 259 | Bos taurus | P00735 (AlphaFold model) |
| Rhodniin | R, S | protein | 103 | Rhodnius prolixus | Q06684 (AlphaFold model) |
Sequence of entity 1 (J, L), FASTA
>1TBR_1 THROMBIN (chains J, L)
TSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR
Sequence of entity 2 (H, K), FASTA
>1TBR_2 THROMBIN (chains H, K)
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLL
VRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCL
PDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIR
ITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFY
THVFRLKKWIQKVIDRLGS
Sequence of entity 3 (R, S), FASTA
>1TBR_3 RHODNIIN (chains R, S)
EGGEPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQEC
DGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT
Primary citation
Two heads are better than one: crystal structure of the insect derived double domain Kazal inhibitor rhodniin in complex with thrombin. van de Locht, A., Lamba, D., Bauer, M. et al. EMBO J (1995) 14:5149-5157. PubMed
Other PDB entries of the same protein (UniProt P00735 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7A0D 1.6 Å, The Crystal Structure of Bovine Thrombin in complex with Hirudin (C16U/C28U) at 1.6…
- 1NL1 1.9 Å, Bovine prothrombin fragment 1 in complex with calcium ion
- 7A0E 1.9 Å, The Crystal Structure of Bovine Thrombin in complex with Hirudin (C6U/C14U) at 1.9…
- 1ETR 2.2 Å, Refined 2.3 Å X-ray crystal structure of bovine thrombin complexes formed with the…
- 1MKX 2.2 Å, The co-crystal structure of unliganded bovine alpha-thrombin and prethrombin-2: movement…
- 1UCY 2.2 Å, Thrombin complexed with fibrinopeptide a alpha (residues 7-19). Three complexes, one…
- 2PF2 2.2 Å, The CA+2 ion and membrane binding structure of the gla domain of ca-prothrombin fragment 1
- 3PMA 2.2 Å, 2.2 Angstrom crystal structure of the complex between Bovine Thrombin and Sucrose…
- 1BBR 2.3 Å, The structure of residues 7-16 of the a alpha chain of human fibrinogen bound to bovine…
- 1ETS 2.3 Å, Refined 2.3 Å X-ray crystal structure of bovine thrombin complexes formed with the…
- 1MKW 2.3 Å, The co-crystal structure of unliganded bovine alpha-thrombin and prethrombin-2: movement…
- 1NL2 2.3 Å, Bovine prothrombin fragment 1 in complex with calcium and lysophosphotidylserine
Browse structure collections
About this viewer
MolViewer shows 1TBR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.