0.97-A structure of the SH3 domain of bbc1. Determined by X-ray diffraction at 0.97 Å resolution. Released 14 Jun 2005.
Explore 1TG0 in 3D Show helices and sheets RCSB PDB PDBe
1TG0 contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-3 | 2 | |
| β-strand | 6-10 | 5 | 1 |
| β-strand | 14 | 1 | 2 |
| β-strand | 21 | 1 | 1 |
| β-strand | 24 | 1 | 2 |
| β-strand | 29-35 | 7 | 1 |
| β-strand | 40-46 | 7 | 1 |
| β-strand | 52-58 | 7 | 1 |
| α-helix | 59-61 | 3 | |
| β-strand | 62-64 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin tail region-interacting protein MTI1 | A | protein | 68 | Saccharomyces cerevisiae | P47068 (AlphaFold model) |
>1TG0_1 Myosin tail region-interacting protein MTI1 (chains A) MSEPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFP KSFVAVQG
Saccharomyces cerevisiae SH3 domain structural genomics. Kursula, P., Kursula, I., Lehmann, F. et al. To be published.
Other PDB entries of the same protein (UniProt P47068 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1TG0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.