2DYF: First WW domain of FBP11 / HYPA

Solution structure of the first WW domain of FBP11 / HYPA (FBP11 WW1) complexed with a PL (PPLP) motif peptide ligand. Determined by solution NMR. Released 24 Oct 2006.

Method: Solution NMR
Organisms: Homo sapiens, Saccharomyces cerevisiae
Chains: 2
Atoms: 317
Mol. weight: 4.51 kDa
Released: 24 Oct 2006

Explore 2DYF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DYF contains 1 α-helix and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	1
β-strand	22-26	5	1
β-strand	31-33	3	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Huntingtin-interacting protein HYPA/FBP11	A	protein	30	Homo sapiens	O75400 (AlphaFold model)
PL (PPLP) motif peptide from Myosin tail region-interacting protein MTI1	B	protein	9	Saccharomyces cerevisiae	P47068 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DYF_1 Huntingtin-interacting protein HYPA/FBP11 (chains A)
GSWTEHKSPDGRTYYYNTETKQSTWEKPDD

Sequence of entity 2 (B), FASTA

>2DYF_2 PL (PPLP) motif peptide from Myosin tail region-interacting protein MTI1 (chains B)
GSTAPPLPR

Primary citation

Complex structure of fbp11 ww1 and a pl ligand reveals the mechanism of proline-rich ligand recognition by group-II/III ww domains. Kato, Y., Miyakawa, T., Kurita, J. et al. To be published.

Other PDB entries of the same protein (UniProt O75400 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UZC The structure of an ff domain from human HYPA/FBP11
1YWI Structure of the FBP11WW1 domain complexed to the peptide APPTPPPLPP
1YWJ Structure of the FBP11WW1 domain
1ZR7 Solution structure of the first WW domain of FBP11
2CQN Solution structure of the FF domain of human Formin-binding protein 3
2KZG A Transient and Low Populated Protein Folding Intermediate at Atomic Resolution
2L5F Solution structure of the tandem WW domains from HYPA/FBP11
2L9V NMR structure of the FF domain L24A mutant's folding transition state
2LKS Ff11-60
8PXW Structure of the WW domain tandem of PRPF40A
8PXX Structure of the WW domain tandem of PRPF40A in complex with SF1

Browse structure collections

About this viewer

MolViewer shows 2DYF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.