1ZUK: Yeast BBC1 Sh3 domain

Yeast BBC1 Sh3 domain complexed with a peptide from Las17. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Aug 2006.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Saccharomyces cerevisiae
Chains: 3
Atoms: 1,354
Mol. weight: 16.91 kDa
Ligands: MG
Released: 15 Aug 2006

Explore 1ZUK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZUK contains 5 α-helices and 16 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-5	2
β-strand	8-12	5	1
β-strand	16	1	2
β-strand	23	1	1
β-strand	26	1	2
β-strand	31-37	7	1
β-strand	42-48	7	1
β-strand	54-60	7	1
α-helix	61-63	3
β-strand	64-66	3	1

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4	1
β-strand	8-12	5	3
β-strand	16	1	4
β-strand	23	1	3
β-strand	26	1	4
β-strand	31-37	7	3
β-strand	42-48	7	3
β-strand	54-60	7	3
α-helix	61-63	3
β-strand	64-66	3	3

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin tail region-interacting protein MTI1	A, B	protein	68	Saccharomyces cerevisiae	P47068 (AlphaFold model)
Proline-rich protein LAS17	C	protein	11		Q12446 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1ZUK_1 Myosin tail region-interacting protein MTI1 (chains A, B)
MSEPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFP
KSFVAVQG

Sequence of entity 2 (C), FASTA

>1ZUK_2 Proline-rich protein LAS17 (chains C)
RGPAPPPPPHR

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Structural genomics of yeast SH3 domains. Kursula, P., Kursula, I., Lehmann, F. et al. To be published.

Other PDB entries of the same protein (UniProt P47068 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TG0 0.97 Å, 0.97-A structure of the SH3 domain of bbc1
1WDX 2.5 Å, Yeast BBC1 SH3 domain, triclinic crystal form
2DYF Solution structure of the first WW domain of FBP11 / HYPA (FBP11 WW1) complexed with a…

Browse structure collections

About this viewer

MolViewer shows 1ZUK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.