Yeast BBC1 SH3 domain, triclinic crystal form. Determined by X-ray diffraction at 2.5 Å resolution. Released 31 May 2005.
Explore 1WDX in 3D Show helices and sheets RCSB PDB PDBe
1WDX contains 8 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6 | 1 | |
| β-strand | 9-13 | 5 | 1 |
| β-strand | 17 | 1 | 2 |
| β-strand | 24 | 1 | 1 |
| α-helix | 25-26 | 2 | |
| β-strand | 27 | 1 | 2 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 43-49 | 7 | 1 |
| β-strand | 55-61 | 7 | 1 |
| α-helix | 62-64 | 3 | |
| β-strand | 65-66 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 5 |
| β-strand | 17 | 1 | 6 |
| β-strand | 24 | 1 | 5 |
| β-strand | 27 | 1 | 6 |
| β-strand | 32-38 | 7 | 5 |
| β-strand | 43-49 | 7 | 5 |
| β-strand | 55-61 | 7 | 5 |
| α-helix | 62-64 | 3 | |
| β-strand | 65-66 | 2 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin tail region-interacting protein MTI1 | A, B, C, D | protein | 69 | Saccharomyces cerevisiae | P47068 (AlphaFold model) |
>1WDX_1 Myosin tail region-interacting protein MTI1 (chains A, B, C, D) GMSEPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIF PKSFVAVQG
Crystal structure of Yeast BBC1 SH3 domain, triclinic crystal form. Wilmanns, M., Consani Textor, L., Kursula, P. et al. To be published.
Other PDB entries of the same protein (UniProt P47068 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1WDX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.