1TLE: Laminin

Le (laminin-type egf-like) module GIII4 in solution at PH 3.5 and 290 K, NMR, 14 structures. Determined by solution NMR. Released 12 Feb 1997.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 439
Mol. weight: 6.35 kDa
Released: 12 Feb 1997

Explore 1TLE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TLE contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	24	1	1
β-strand	31-32	2	2
β-strand	38-39	2	2
β-strand	44-45	2	3
α-helix	52-54	3
β-strand	56-57	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Laminin	A	protein	58	Mus musculus	P02468 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1TLE_1 LAMININ (chains A)
RPCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKA

Primary citation

Structure of the nidogen binding LE module of the laminin gamma1 chain in solution. Baumgartner, R., Czisch, M., Mayer, U. et al. J Mol Biol (1996) 257:658-668. DOI 10.1006/jmbi.1996.0192 · PubMed

Other PDB entries of the same protein (UniProt P02468 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KLO 2.1 Å, Crystal structure of three consecutive laminin-type epidermal growth factor-like (LE)…
5MC9 2.13 Å, Crystal structure of the heterotrimeric integrin-binding region of laminin-111
1NPE 2.3 Å, Crystal structure of Nidogen/Laminin Complex
4AQT 3.2 Å, Laminin gamma1 LN-LE1-2 structure

Browse structure collections

About this viewer

MolViewer shows 1TLE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.