Triglycine variant of the Grp1 Pleckstrin Homology Domain unliganded. Determined by X-ray diffraction at 1.8 Å resolution. Released 1 Feb 2005.
Explore 1U2B in 3D Show helices and sheets RCSB PDB PDBe
1U2B contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 267-274 | 8 | 1 |
| β-strand | 282-290 | 9 | 1 |
| β-strand | 293-297 | 5 | 1 |
| β-strand | 307-310 | 4 | 1 |
| β-strand | 315-318 | 4 | 1 |
| β-strand | 327-331 | 5 | 1 |
| α-helix | 338-341 | 4 | |
| β-strand | 343-345 | 3 | 1 |
| β-strand | 351-353 | 3 | 1 |
| β-strand | 358-362 | 5 | 1 |
| α-helix | 366-382 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytohesin 3 | A | protein | 138 | Mus musculus | O08967 (AlphaFold model) |
>1U2B_1 Cytohesin 3 (chains A) MGHHHHHHGSTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIP LENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKE EWMKSIKASISRDPFYDM
Structural determinants of phosphoinositide selectivity in splice variants of Grp1 family PH domains. Cronin, T.C., DiNitto, J.P., Czech, M.P. et al. EMBO J (2004) 23:3711-3720. DOI 10.1038/sj.emboj.7600388 · PubMed
Other PDB entries of the same protein (UniProt O08967 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1U2B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.