1U4A: Human SUMO-3 C47S

Solution structure of human SUMO-3 C47S. Determined by solution NMR. Released 8 Mar 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 633
Mol. weight: 10.12 kDa
Released: 8 Mar 2005

Explore 1U4A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U4A contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	1
β-strand	27-33	7	1
α-helix	39-50	12
β-strand	58-60	3	1
β-strand	65-66	2	1
α-helix	72-76	5
β-strand	81-86	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein SMT3A	A	protein	87	Homo sapiens	P55854 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1U4A_1 Ubiquitin-like protein SMT3A (chains A)
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYSERQGLSMRQIRFRFDGQPINETDTPA
QLEMEDEDTIDVFQQQTGGLEHHHHHH

Primary citation

Solution Structure of Human SUMO-3 C47S and Its Binding Surface for Ubc9. Ding, H., Xu, Y., Chen, Q. et al. Biochemistry (2005) 44:2790-2799. DOI 10.1021/bi0477586 · PubMed

Other PDB entries of the same protein (UniProt P55854 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7R2E 1.74 Å, Structure of human Senp7 with SUMO2
7ZJU 2.17 Å, Structure of human USPL1 in covalent complex with SUMO3-2Br probe
9GNN 2.36 Å, Structure of SENP5 in complex with SUMO2
2IO1 2.6 Å, Crystal structure of human Senp2 in complex with preSUMO-3
6NNQ 2.62 Å, Non-covalent structure of SENP1 in complex with SUMO2
2MP2 Solution structure of SUMO dimer in complex with SIM2-3 from RNF4
6K5R Complex of SUMO2 with Phosphorylated viral SIM IE2

Browse structure collections

About this viewer

MolViewer shows 1U4A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.