6K5R: Small ubiquitin-related modifier 3

Complex of SUMO2 with Phosphorylated viral SIM IE2. Determined by solution NMR. Released 7 Aug 2019.

Method: Solution NMR
Organisms: Homo sapiens, Human cytomegalovirus (strain AD169)
Chains: 2
Atoms: 711
Mol. weight: 10.26 kDa
Released: 7 Aug 2019

Explore 6K5R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6K5R contains 2 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	18-23	6	1
β-strand	29-34	6	1
α-helix	41-51	11
β-strand	58-62	5	1
β-strand	65-66	2	1
α-helix	67-68	2
β-strand	83-88	6	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	197-201	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small ubiquitin-related modifier 3	A	protein	77	Homo sapiens	P55854 (AlphaFold model)
Asp-thr-ala-gly-cys-ile-val-ile-sep-asp-sep-glu	B	protein	12	Human cytomegalovirus (strain AD169)	P19893

Sequence of entity 1 (A), FASTA

>6K5R_1 Small ubiquitin-related modifier 3 (chains A)
DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQ
LEMEDEDTIDVFQQQTG

Sequence of entity 2 (B), FASTA

>6K5R_2 ASP-THR-ALA-GLY-CYS-ILE-VAL-ILE-SEP-ASP-SEP-GLU (chains B)
DTAGCIVISDSE

Primary citation

Casein kinase-2-mediated phosphorylation increases the SUMO-dependent activity of the cytomegalovirus transactivator IE2. Tripathi, V., Chatterjee, K.S., Das, R. J Biol Chem (2019) 294:14546-14561. DOI 10.1074/jbc.RA119.009601 · PubMed

Other PDB entries of the same protein (UniProt P55854 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7R2E 1.74 Å, Structure of human Senp7 with SUMO2
7ZJU 2.17 Å, Structure of human USPL1 in covalent complex with SUMO3-2Br probe
9GNN 2.36 Å, Structure of SENP5 in complex with SUMO2
2IO1 2.6 Å, Crystal structure of human Senp2 in complex with preSUMO-3
6NNQ 2.62 Å, Non-covalent structure of SENP1 in complex with SUMO2
1U4A Solution structure of human SUMO-3 C47S
2MP2 Solution structure of SUMO dimer in complex with SIM2-3 from RNF4

Browse structure collections

About this viewer

MolViewer shows 6K5R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.