1U4C: Spindle checkpoint protein Bub3

Structure of spindle checkpoint protein Bub3. Determined by X-ray diffraction at 2.35 Å resolution. Released 3 Aug 2004.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 5,511
Mol. weight: 79.39 kDa
Released: 3 Aug 2004

Explore 1U4C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U4C contains 14 α-helices and 65 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	14-20	7	2
α-helix	21-23	3
β-strand	25-30	6	2
β-strand	35-41	7	2
β-strand	46-53	8	2
α-helix	58	1
β-strand	59-65	7	3
β-strand	71-76	6	3
β-strand	81-84	4	3
β-strand	92-94	3	3
α-helix	95	1
β-strand	96	1	4
β-strand	104-109	6	5
β-strand	112	1	6
β-strand	114	1	6
β-strand	115-119	5	5
β-strand	123-127	5	5
α-helix	129-132	4
β-strand	135	1	4
β-strand	137-141	5	5
β-strand	155	1	7
β-strand	158	1	7
β-strand	162-166	5	7
β-strand	171-176	6	7
β-strand	185-189	5	7
β-strand	196-201	6	8
β-strand	208-213	6	8
β-strand	217-222	6	8
β-strand	236-239	4	8
β-strand	254-259	6	9
β-strand	266-270	5	9
β-strand	275-279	5	9
α-helix	280-282	3
β-strand	284-288	5	9
α-helix	289-291	3
β-strand	296-303	8	1
β-strand	306-312	7	1
α-helix	315-318	4
α-helix	326-329	4
β-strand	333-337	5	1

Chain B: 6 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	10
β-strand	14-20	7	11
β-strand	25-30	6	11
β-strand	34-41	8	11
β-strand	46-54	9	11
β-strand	59-65	7	12
β-strand	71-76	6	12
β-strand	81-84	4	12
β-strand	92-94	3	12
β-strand	96	1	13
β-strand	104-109	6	14
β-strand	110	1	15
β-strand	112	1	15
β-strand	115-119	5	14
β-strand	123-127	5	14
α-helix	129-132	4
β-strand	135	1	13
β-strand	137-141	5	14
β-strand	153-159	7	16
β-strand	162-167	6	16
β-strand	171-176	6	16
β-strand	186-189	4	16
β-strand	196-201	6	17
α-helix	202-203	2
α-helix	204-206	3
β-strand	208-213	6	17
β-strand	217-222	6	17
β-strand	236-239	4	17
β-strand	254-259	6	18
β-strand	266-270	5	18
β-strand	274-279	6	18
β-strand	284-288	5	18
α-helix	289-291	3
β-strand	296-302	7	10
β-strand	306-312	7	10
α-helix	315-318	4
α-helix	326-331	6
β-strand	332-337	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell cycle arrest protein BUB3	A, B	protein	349	Saccharomyces cerevisiae	P26449 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1U4C_1 Cell cycle arrest protein BUB3 (chains A, B)
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL
CCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW
DGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLC
EDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRC
HRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKI
ACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYENLEHHHHHH

Primary citation

Crystal structure of the spindle assembly checkpoint protein Bub3. Larsen, N.A., Harrison, S.C. J Mol Biol (2004) 344:885-892. DOI 10.1016/j.jmb.2004.09.094 · PubMed

Other PDB entries of the same protein (UniProt P26449 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YFQ 1.1 Å, High resolution S. cerevisiae Bub3 mitotic checkpoint protein
2I3S 1.9 Å, Bub3 complex with Bub1 GLEBS motif
4BL0 1.95 Å, Crystal structure of yeast Bub3-Bub1 bound to phospho-Spc105
2I3T 2.8 Å, Bub3 complex with Mad3 (BubR1) GLEBS motif

Browse structure collections

About this viewer

MolViewer shows 1U4C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.