1U59: ZAP-70 Kinase Domain

Crystal Structure of the ZAP-70 Kinase Domain in Complex with Staurosporine. Determined by X-ray diffraction at 2.3 Å resolution. Released 17 Aug 2004.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,376
Mol. weight: 33.71 kDa
Ligands: STU
Released: 17 Aug 2004

Explore 1U59 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U59 contains 17 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	331	1	1
α-helix	334-336	3
β-strand	337-345	9	1
β-strand	350-357	8	1
β-strand	364-371	8	1
α-helix	372	1
α-helix	377-392	16
β-strand	398	1	2
α-helix	399-400	2
β-strand	401-406	6	1
β-strand	410-415	6	1
β-strand	420-421	2	2
α-helix	422-426	5
α-helix	435-454	20
β-strand	457-458	2	3
α-helix	464-466	3
β-strand	467-471	5	2
β-strand	474-477	4	2
β-strand	484-485	2	3
β-strand	492-493	2	4
α-helix	503-505	3
α-helix	508-513	6
β-strand	515-516	2	4
α-helix	518-533	16
α-helix	537-538	2
β-strand	541	1	5
β-strand	543	1	5
α-helix	546-553	8
α-helix	558-561	4
α-helix	566-574	9
α-helix	580-582	3
α-helix	584-585	2
α-helix	586-601	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase ZAP-70	A	protein	287	Homo sapiens	P43403 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1U59_1 Tyrosine-protein kinase ZAP-70 (chains A)
DKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMRE
AQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVS
MGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAGKWPLKWY
APECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPP
ELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
STU	Staurosporine	C28 H26 N4 O3	1

Primary citation

The Three-dimensional Structure of the ZAP-70 Kinase Domain in Complex with Staurosporine: IMPLICATIONS FOR THE DESIGN OF SELECTIVE INHIBITORS. Jin, L., Pluskey, S., Petrella, E.C. et al. J Biol Chem (2004) 279:42818-42825. DOI 10.1074/jbc.M407096200 · PubMed

Other PDB entries of the same protein (UniProt P43403 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SIY 1.48 Å, cCBL TKB domain in complex with pZAP70 peptide
2OQ1 1.9 Å, Tandem SH2 domains of ZAP-70 with 19-mer zeta1 peptide
2Y1N 2.0 Å, Structure of c-Cbl-ZAP-70 peptide complex
4XZ0 2.0 Å, ZAP-70-tSH2:compound-A complex
2CBL 2.1 Å, N-terminal domain of cbl in complex with its binding site on zap-70
3ZNI 2.21 Å, Structure of phosphoTyr363-Cbl-b - UbcH5B-Ub - ZAP-70 peptide complex
5O76 2.47 Å, Structure of phosphoY371 c-CBL in complex with ZAP70-peptide and UbV.pCBL ubiquitin…
1M61 2.5 Å, Crystal structure of the apo SH2 domains of ZAP-70
2OZO 2.6 Å, Autoinhibited intact human ZAP-70
4A4C 2.7 Å, Structure of phosphoTyr371-c-Cbl-UbcH5B-ZAP-70 complex
4A4B 2.79 Å, Structure of modified phosphoTyr371-c-Cbl-UbcH5B-ZAP-70 complex
4XZ1 2.8 Å, ZAP-70-tSH2:Compound-B adduct

Browse structure collections

About this viewer

MolViewer shows 1U59 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.