Autoinhibited intact human ZAP-70. Determined by X-ray diffraction at 2.6 Å resolution. Released 22 May 2007.
Explore 2OZO in 3D Show helices and sheets RCSB PDB PDBe
2OZO contains 20 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11 | 1 | 1 |
| β-strand | 13 | 1 | 2 |
| α-helix | 17-25 | 9 | |
| β-strand | 33-38 | 6 | 1 |
| β-strand | 42 | 1 | 3 |
| β-strand | 46-52 | 7 | 1 |
| β-strand | 55-63 | 9 | 1 |
| β-strand | 69-71 | 3 | 1 |
| β-strand | 77 | 1 | 1 |
| α-helix | 80-87 | 8 | |
| β-strand | 101 | 1 | 1 |
| α-helix | 103-105 | 3 | |
| β-strand | 111 | 1 | 2 |
| α-helix | 114-131 | 18 | |
| α-helix | 135-153 | 19 | |
| β-strand | 164 | 1 | 3 |
| α-helix | 170-177 | 8 | |
| β-strand | 187-191 | 5 | 3 |
| β-strand | 197-204 | 8 | 3 |
| β-strand | 207-215 | 9 | 3 |
| β-strand | 221-222 | 2 | 3 |
| β-strand | 228-229 | 2 | 3 |
| α-helix | 232-241 | 10 | |
| β-strand | 253 | 1 | 3 |
| β-strand | 331 | 1 | 4 |
| α-helix | 332-333 | 2 | |
| β-strand | 337-346 | 10 | 4 |
| β-strand | 351-358 | 8 | 4 |
| β-strand | 363-370 | 8 | 4 |
| α-helix | 380-390 | 11 | |
| β-strand | 398 | 1 | 5 |
| β-strand | 401-406 | 6 | 4 |
| β-strand | 410-415 | 6 | 4 |
| β-strand | 421 | 1 | 5 |
| α-helix | 422-426 | 5 | |
| α-helix | 435-454 | 20 | |
| α-helix | 464-466 | 3 | |
| β-strand | 467-471 | 5 | 5 |
| β-strand | 474-477 | 4 | 5 |
| β-strand | 484 | 1 | 6 |
| β-strand | 486 | 1 | 6 |
| α-helix | 508-513 | 6 | |
| α-helix | 518-533 | 16 | |
| α-helix | 537-538 | 2 | |
| α-helix | 546-553 | 8 | |
| α-helix | 558-561 | 4 | |
| α-helix | 566-574 | 9 | |
| α-helix | 584-585 | 2 | |
| α-helix | 586-600 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein kinase ZAP-70 | A | protein | 613 | Homo sapiens | P43403 (AlphaFold model) |
>2OZO_1 Tyrosine-protein kinase ZAP-70 (chains A) MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG AQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK LKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARIT SPDKPRPMPMDTSVFESPFSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMR KKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG PLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRNLAARNVLLVNRHYAKISDF GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPY KKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSL ASKVEGGSALEVA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ANP | Phosphoaminophosphonic acid-adenylate ester | C10 H17 N6 O12 P3 | 1 |
| MG | Magnesium ion | Mg | 1 |
Structural Basis for the Inhibition of Tyrosine Kinase Activity of ZAP-70. Deindl, S., Kadlecek, T.A., Brdicka, T. et al. Cell (2007) 129:735-746. DOI 10.1016/j.cell.2007.03.039 · PubMed
Other PDB entries of the same protein (UniProt P43403 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OZO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.