1U5S: Cytoplasmic protein NCK2

NMR structure of the complex between Nck-2 SH3 domain and PINCH-1 LIM4 domain. Determined by solution NMR. Released 5 Apr 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,093
Mol. weight: 15.73 kDa
Ligands: ZN
Released: 5 Apr 2005

Explore 1U5S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U5S contains 1 α-helix and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
β-strand	22	1	1
β-strand	31-35	5	1
β-strand	43-48	6	1
β-strand	52-57	6	1
β-strand	61-63	3	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	78-79	2	2
β-strand	84-85	2	2
β-strand	90-91	2	3
β-strand	97	1	2
β-strand	98-99	2	3
β-strand	104	1	4
β-strand	111	1	4
β-strand	118-120	3	5
β-strand	123-125	3	5
α-helix	127-133	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytoplasmic protein NCK2	A	protein	71	Homo sapiens	O43639 (AlphaFold model)
PINCH protein	B	protein	66	Homo sapiens	P48059 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1U5S_1 Cytoplasmic protein NCK2 (chains A)
QGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNY
VVVLSDGPALH

Sequence of entity 2 (B), FASTA

>1U5S_2 PINCH protein (chains B)
GSMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYN
QLFGDV

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structure of an ultraweak protein-protein complex and its crucial role in regulation of cell morphology and motility. Vaynberg, J., Fukuda, T., Chen, K. et al. Mol Cell (2005) 17:513-523. DOI 10.1016/j.molcel.2004.12.031 · PubMed

Other PDB entries of the same protein (UniProt O43639 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CIA 1.45 Å, human nck2 sh2-domain in complex with a decaphosphopeptide from translocated intimin…
4E6R 2.2 Å, Crystal structure of a Cytoplasmic protein NCK2 (NCK2) from Homo sapiens at 2.20 A…
1WX6 Solution structure of the SH3 domain of the human cytoplasmic protein NCK2
1Z3K Structural Insight into the Binding Diversity between the Tyr-Phosphorylated Human…
2B86 Solution structure of the first Src homology 3 domain of Nck2
2FRW Solution structure of the second SH3 domain of human adaptor protein NCK2
2FRY Solution structure of the third SH3 domain of human NCK2 adaptor protein
2JXB Structure of CD3epsilon-Nck2 first SH3 domain complex

Browse structure collections

About this viewer

MolViewer shows 1U5S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.