human nck2 sh2-domain in complex with a decaphosphopeptide from translocated intimin receptor (tir) of epec. Determined by X-ray diffraction at 1.45 Å resolution. Released 24 Apr 2006.
Explore 2CIA in 3D Show helices and sheets RCSB PDB PDBe
2CIA contains 3 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 286 | 1 | 1 |
| α-helix | 292-302 | 11 | |
| β-strand | 307-312 | 6 | 1 |
| β-strand | 320-324 | 5 | 1 |
| β-strand | 331-335 | 5 | 1 |
| β-strand | 336-338 | 3 | 2 |
| β-strand | 341-344 | 4 | 2 |
| β-strand | 347-349 | 3 | 2 |
| α-helix | 352-361 | 10 | |
| β-strand | 365-366 | 2 | 3 |
| β-strand | 372-373 | 2 | 3 |
| β-strand | 377-378 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 475-478 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytoplasmic protein NCK2 | A | protein | 102 | HOMO SAPIENS | O43639 (AlphaFold model) |
| Translocated intimin receptor | L | protein | 11 | ESCHERICHIA COLI | B7UM99 (AlphaFold model) |
>2CIA_1 CYTOPLASMIC PROTEIN NCK2 (chains A) GPLGSEWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLV DNVYCIGQRRFHTMDELVEHYKKAPIFTSEHGEKLYLVRALQ
>2CIA_2 TRANSLOCATED INTIMIN RECEPTOR (chains L) XHIYDEVAADP
| ID | Name | Formula | Copies |
|---|---|---|---|
| IPA | Isopropyl alcohol | C3 H8 O | 1 |
Water and common crystallization additives (MPD) are not listed.
The Phosphotyrosine Peptide Binding Specificity of Nck1 and Nck2 Src Homology 2 Domains. Frese, S., Schubert, W.-D., Findeis, A.C. et al. J Biol Chem (2006) 281:18236. DOI 10.1074/JBC.M512917200 · PubMed
Other PDB entries of the same protein (UniProt O43639 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2CIA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.