2CIA: Human nck2 sh2-domain

Name: PDB 2CIA: human nck2 sh2-domain in complex with a decaphosphopeptide from translocated intimin receptor (tir) of epec
Published: 2006-04-24
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: sh2-domain

human nck2 sh2-domain in complex with a decaphosphopeptide from translocated intimin receptor (tir) of epec. Determined by X-ray diffraction at 1.45 Å resolution. Released 24 Apr 2006.

Method: X-ray diffraction
Resolution: 1.45 Å
Organisms: HOMO SAPIENS, ESCHERICHIA COLI
Chains: 2
Atoms: 1,102
Mol. weight: 13.09 kDa
Ligands: IPA
Released: 24 Apr 2006

Explore 2CIA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CIA contains 3 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	286	1	1
α-helix	292-302	11
β-strand	307-312	6	1
β-strand	320-324	5	1
β-strand	331-335	5	1
β-strand	336-338	3	2
β-strand	341-344	4	2
β-strand	347-349	3	2
α-helix	352-361	10
β-strand	365-366	2	3
β-strand	372-373	2	3
β-strand	377-378	2	1

Chain L: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	475-478	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytoplasmic protein NCK2	A	protein	102	HOMO SAPIENS	O43639 (AlphaFold model)
Translocated intimin receptor	L	protein	11	ESCHERICHIA COLI	B7UM99 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CIA_1 CYTOPLASMIC PROTEIN NCK2 (chains A)
GPLGSEWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLV
DNVYCIGQRRFHTMDELVEHYKKAPIFTSEHGEKLYLVRALQ

Sequence of entity 2 (L), FASTA

>2CIA_2 TRANSLOCATED INTIMIN RECEPTOR (chains L)
XHIYDEVAADP

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	1

Water and common crystallization additives (MPD) are not listed.

Primary citation

The Phosphotyrosine Peptide Binding Specificity of Nck1 and Nck2 Src Homology 2 Domains. Frese, S., Schubert, W.-D., Findeis, A.C. et al. J Biol Chem (2006) 281:18236. DOI 10.1074/JBC.M512917200 · PubMed

Other PDB entries of the same protein (UniProt O43639 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4E6R 2.2 Å, Crystal structure of a Cytoplasmic protein NCK2 (NCK2) from Homo sapiens at 2.20 A…
1U5S NMR structure of the complex between Nck-2 SH3 domain and PINCH-1 LIM4 domain
1WX6 Solution structure of the SH3 domain of the human cytoplasmic protein NCK2
1Z3K Structural Insight into the Binding Diversity between the Tyr-Phosphorylated Human…
2B86 Solution structure of the first Src homology 3 domain of Nck2
2FRW Solution structure of the second SH3 domain of human adaptor protein NCK2
2FRY Solution structure of the third SH3 domain of human NCK2 adaptor protein
2JXB Structure of CD3epsilon-Nck2 first SH3 domain complex

Browse structure collections

About this viewer

MolViewer shows 2CIA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.