1U7F: Mothers against decapentaplegic homolog 3

Crystal Structure of the phosphorylated Smad3/Smad4 heterotrimeric complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 28 Sept 2004.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,983
Mol. weight: 71 kDa
Released: 28 Sept 2004

Explore 1U7F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U7F contains 29 α-helices and 36 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	233-239	7	1
β-strand	242-243	2	1
β-strand	248-250	3	1
β-strand	254-258	5	2
β-strand	268-270	3	2
α-helix	271-273	3
α-helix	281-286	6
α-helix	287-289	3
β-strand	294-299	6	2
β-strand	302-307	6	2
β-strand	313-316	4	1
α-helix	318-323	6
β-strand	332-334	3	1
β-strand	339-344	6	2
α-helix	345-353	9
α-helix	356-358	3
α-helix	360-364	5
α-helix	365-370	6
β-strand	371-376	6	1
α-helix	389-391	3
β-strand	395-400	6	1
α-helix	401-411	11

Chain B: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	318-320	3
β-strand	322-329	8	3
β-strand	334	1	3
α-helix	337-338	2
β-strand	339-342	4	3
β-strand	347-351	5	4
β-strand	361-363	3	4
α-helix	364-366	3
α-helix	374-381	8
β-strand	387-391	5	4
β-strand	397-400	4	4
β-strand	407-410	4	3
α-helix	413-416	4
β-strand	427-429	3	3
α-helix	430	1
β-strand	434-438	5	4
α-helix	440-454	15
α-helix	492-495	4
α-helix	496-499	4
β-strand	500-505	6	3
α-helix	518-520	3
β-strand	524-528	5	3
α-helix	530-540	11

Chain C: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	233-239	7	5
β-strand	242-243	2	5
α-helix	246-247	2
β-strand	248-250	3	5
β-strand	254-258	5	6
β-strand	268-270	3	6
α-helix	281-287	7
β-strand	294-299	6	6
β-strand	302-307	6	6
β-strand	313-316	4	5
α-helix	318-321	4
β-strand	332-334	3	5
β-strand	339-344	6	6
α-helix	345-353	9
α-helix	360-364	5
α-helix	365-370	6
β-strand	371-376	6	5
α-helix	389-391	3
β-strand	395-400	6	5
α-helix	401-411	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mothers against decapentaplegic homolog 3	A, C	protein	198	Homo sapiens	P84022 (AlphaFold model)
Mothers against decapentaplegic homolog 4	B	protein	239	Homo sapiens	Q13485 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1U7F_1 Mothers against decapentaplegic homolog 3 (chains A, C)
EPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTR
RHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQE
FAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWL
DKVLTQMGSPSIRCSSVS

Sequence of entity 2 (B), FASTA

>1U7F_2 Mothers against decapentaplegic homolog 4 (chains B)
ISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRT
EAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSA
YIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVD
DLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD

Primary citation

Structural basis of heteromeric smad protein assembly in tgf-Beta signaling. Chacko, B.M., Qin, B.Y., Tiwari, A. et al. Mol Cell (2004) 15:813-823. DOI 10.1016/j.molcel.2004.07.016 · PubMed

Other PDB entries of the same protein (UniProt P84022 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YIB 1.7 Å, 14-3-3 sigma in complex with SMAD3 pS423 peptide
1MJS 1.91 Å, MH2 domain of transcriptional factor SMAD3
5OD6 2.0 Å, Crystal structure of Smad3-MH1 bound to the GGCGC site.
5ODG 2.12 Å, Crystal structure of Smad3-MH1 bound to the GGCT site.
6ZMN 2.33 Å, Crystal structure of the Smad3-Smad5 MH1 domain chimera bound to the GGCGC site
1OZJ 2.4 Å, Crystal structure of Smad3-MH1 bound to DNA at 2.4 A resolution
5XOC 2.4 Å, Crystal structure of human Smad3-FoxH1 complex
1MK2 2.74 Å, SMAD3 SBD complex
1MHD 2.8 Å, Crystal structure of a smad MH1 domain bound to DNA
2LAJ Third WW domain of human Nedd4L in complex with doubly phosphorylated human smad3…
2LB2 Structure of the second domain of human Nedd4L in complex with a phosphorylated pTPY…

Browse structure collections

About this viewer

MolViewer shows 1U7F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.