1UG1: SH3 domain of Hypothetical protein BAA76854.1

SH3 domain of Hypothetical protein BAA76854.1. Determined by solution NMR. Released 11 Dec 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 695
Mol. weight: 9.87 kDa
Released: 11 Dec 2003

Explore 1UG1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UG1 contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	16-18	3
β-strand	19-22	4	1
β-strand	41-46	6	1
β-strand	56-60	5	1
β-strand	65-69	5	1
α-helix	70-72	3
β-strand	73-75	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KIAA1010 protein	A	protein	92	Homo sapiens	Q6XZF7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UG1_1 KIAA1010 protein (chains A)
GSSGSSGASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLID
NGVTKGFVYSSFLKPYNPRRSHSDASSGPSSG

Primary citation

NMR structure of SH3 domain of Hypothetical protein BAA76854.1. Nagata, T., Muto, Y., Kamewari, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q6XZF7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CC2 1.55 Å, Complex of human Tuba C-terminal SH3 domain with human N-WASP proline- rich peptide -…
4GLM 1.9 Å, Crystal structure of the SH3 Domain of DNMBP protein [Homo sapiens]
4CC3 1.97 Å, Complex of human Tuba C-terminal SH3 domain and Mena proline-rich peptide - H3
4CC7 1.97 Å, Crystal structure of the sixth or C-terminal SH3 domain of human Tuba in complex with…
4CC4 2.6 Å, Complex of InlC of Listeria monocytogenes and human Tuba C-terminal SH3 domain
1UHC Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]

Browse structure collections

About this viewer

MolViewer shows 1UG1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.